BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044661
         (326 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q1MDD6|DER_RHIL3 GTPase Der OS=Rhizobium leguminosarum bv. viciae (strain 3841)
           GN=der PE=3 SV=1
          Length = 473

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 248 MSGLIGWGWEKLMAAMMDGEDFWKGNKWTVVMGSW 282
           +SG  GWG +KLM A++D +  W     T  +  W
Sbjct: 355 ISGQTGWGLDKLMQAIIDTDKVWNKRISTARLNRW 389


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.326    0.136    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 111,204,587
Number of Sequences: 539616
Number of extensions: 4185307
Number of successful extensions: 14076
Number of sequences better than 100.0: 41
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 39
Number of HSP's that attempted gapping in prelim test: 14060
Number of HSP's gapped (non-prelim): 43
length of query: 326
length of database: 191,569,459
effective HSP length: 118
effective length of query: 208
effective length of database: 127,894,771
effective search space: 26602112368
effective search space used: 26602112368
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)