BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044661
(326 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q1MDD6|DER_RHIL3 GTPase Der OS=Rhizobium leguminosarum bv. viciae (strain 3841)
GN=der PE=3 SV=1
Length = 473
Score = 32.7 bits (73), Expect = 3.6, Method: Compositional matrix adjust.
Identities = 13/35 (37%), Positives = 19/35 (54%)
Query: 248 MSGLIGWGWEKLMAAMMDGEDFWKGNKWTVVMGSW 282
+SG GWG +KLM A++D + W T + W
Sbjct: 355 ISGQTGWGLDKLMQAIIDTDKVWNKRISTARLNRW 389
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.326 0.136 0.423
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 111,204,587
Number of Sequences: 539616
Number of extensions: 4185307
Number of successful extensions: 14076
Number of sequences better than 100.0: 41
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 39
Number of HSP's that attempted gapping in prelim test: 14060
Number of HSP's gapped (non-prelim): 43
length of query: 326
length of database: 191,569,459
effective HSP length: 118
effective length of query: 208
effective length of database: 127,894,771
effective search space: 26602112368
effective search space used: 26602112368
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)