Citrus Sinensis ID: 044678

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MAIALSLFSSASTLNEWSPAHATFYGDMAGNETMYGACGYGDLFKQGYGLETTALSTALFNNGQTCGACYQIVCYNSKWCLKGAGAIGVTATNFCPPNYSKPHENWCNPPLKHFDLSQPMFRKIAEYKGGIVPVLYRRVSCVKSGGVMFEMLGNPYWILVLVYNVGGAGEVINVKIKGSSTGWIQMSRNWGQNWQTSAQLLGQSLSFQVTTSDGKMVQFDDVAPPHWQFGDVFEGKQNF
cEEEEEcccccccccccCEEEEEEEcccccccccccccccccccccccccEEEEEcccccccccccccEEEEEEccccccccccccEEEEECcccccccccccccccccccccccccHHHHHHcEEccccEEEEEEEEEEEEccccEEEEEcccccEEEEEEEEEcccccEEEEEEEcccccEEEccccccccEEEccccccccEEEEEEEccccEEEEccccccccccccEECccccc
MAIALS*FSSASTLNEWSPAHATFYGDMAGNETMYGACGYGDLFKQGYGLETTALSTALFNNGQTCGACYQIVCYNSKWCLKGAGAIGVTATNFCPPNYSKPHENWCNPPLKHFDLSQPMFRKIAEYKGGIVPVLYRRVSCVKSGGVMFEMLGNPYWILVLVYNVGGAGEVINVKIKGSSTGWIQMSRNWGQNWQTSAQLLGQSLSFQVTTSDGKMVQFDDVAPPHWQFGDVFEGKQNF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIALSLFSSASTLNEWSPAHATFYGDMAGNETMYGACGYGDLFKQGYGLETTALSTALFNNGQTCGACYQIVCYNSKWCLKGAGAIGVTATNFCPPNYSKPHENWCNPPLKHFDLSQPMFRKIAEYKGGIVPVLYRRVSCVKSGGVMFEMLGNPYWILVLVYNVGGAGEVINVKIKGSSTGWIQMSRNWGQNWQTSAQLLGQSLSFQVTTSDGKMVQFDDVAPPHWQFGDVFEGKQNF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Expansin-A25 Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found.probableQ9FL77
Expansin-A4 Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. Required for normal plant growth. May be required for rapid internodal elongation in deepwater rice during submergence.probableQ0DHB7
Expansin-A23 Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found.probableQ9FL79

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HCZ, chain X
Confidence level:very confident
Coverage over the Query: 13-96,107-238
View the alignment between query and template
View the model in PyMOL