Query         044687
Match_columns 111
No_of_seqs    158 out of 978
Neff          8.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:47:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044687.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044687hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02824 hydrolase, alpha/beta  98.9 5.3E-09 1.1E-13   75.9   6.9   28   78-105   225-252 (294)
  2 PLN02679 hydrolase, alpha/beta  98.9 1.4E-08 3.1E-13   76.4   8.3   43   62-104   267-309 (360)
  3 KOG1454 Predicted hydrolase/ac  98.6 1.4E-08 3.1E-13   76.0   2.5   46   60-105   234-282 (326)
  4 PLN02578 hydrolase              98.6 1.5E-07 3.2E-12   70.6   6.4   47   59-105   264-314 (354)
  5 TIGR02240 PHA_depoly_arom poly  98.3 5.1E-07 1.1E-11   65.0   2.9   25   81-105   201-225 (276)
  6 PRK03592 haloalkane dehalogena  98.2 5.6E-06 1.2E-10   60.0   7.2   23   81-103   222-244 (295)
  7 TIGR03343 biphenyl_bphD 2-hydr  98.0 5.3E-05 1.1E-09   54.1   8.8   27   79-105   215-241 (282)
  8 PRK11126 2-succinyl-6-hydroxy-  97.9 0.00017 3.6E-09   50.4   9.9   24   78-101   179-202 (242)
  9 PRK07581 hypothetical protein;  97.9 5.6E-05 1.2E-09   56.1   7.5   27   78-104   266-292 (339)
 10 KOG2984 Predicted hydrolase [G  97.9 3.8E-05 8.2E-10   54.7   5.4   43   63-105   192-234 (277)
 11 PLN03087 BODYGUARD 1 domain co  97.8 2.3E-05   5E-10   61.7   3.8   25   81-105   412-436 (481)
 12 TIGR03056 bchO_mg_che_rel puta  97.7 0.00022 4.7E-09   50.4   7.3   25   80-104   213-237 (278)
 13 PRK03204 haloalkane dehalogena  97.5 0.00037 8.1E-09   50.7   6.7   21    2-22     91-111 (286)
 14 TIGR03611 RutD pyrimidine util  97.5 0.00017 3.8E-09   49.9   4.1   27   79-105   190-216 (257)
 15 TIGR02427 protocat_pcaD 3-oxoa  97.5  0.0013 2.8E-08   45.0   8.3   27   79-105   185-211 (251)
 16 PF12697 Abhydrolase_6:  Alpha/  97.4 8.2E-06 1.8E-10   55.0  -3.3   26   78-103   167-192 (228)
 17 PRK14875 acetoin dehydrogenase  97.4 0.00039 8.4E-09   51.7   5.2   28   78-105   305-332 (371)
 18 PRK05077 frsA fermentation/res  97.3 0.00041 8.9E-09   53.6   4.6   22   84-105   352-373 (414)
 19 PRK06489 hypothetical protein;  97.1 0.00029 6.2E-09   53.0   2.5   28   78-105   283-310 (360)
 20 TIGR01250 pro_imino_pep_2 prol  97.1  0.0044 9.6E-08   43.3   8.3   22   80-101   224-245 (288)
 21 PHA02857 monoglyceride lipase;  97.0 0.00019 4.1E-09   51.4   0.6   26   80-105   202-227 (276)
 22 PLN02980 2-oxoglutarate decarb  96.9  0.0028 6.1E-08   56.5   7.0   25   78-102  1559-1583(1655)
 23 PRK10349 carboxylesterase BioH  96.9 0.00043 9.4E-09   49.0   1.2   27   78-104   187-213 (256)
 24 TIGR03695 menH_SHCHC 2-succiny  96.9  0.0045 9.7E-08   42.0   6.2   25   78-102   185-209 (251)
 25 PRK11071 esterase YqiA; Provis  96.8 0.00025 5.4E-09   49.1  -0.4   27    2-28     51-77  (190)
 26 PLN02298 hydrolase, alpha/beta  96.8 0.00035 7.6E-09   51.6   0.3   26   80-105   244-269 (330)
 27 PLN02511 hydrolase              96.6  0.0015 3.3E-08   49.9   2.7   26   80-105   291-316 (388)
 28 TIGR01738 bioH putative pimelo  96.5  0.0016 3.4E-08   44.4   2.1   28   78-105   179-206 (245)
 29 PLN02385 hydrolase; alpha/beta  96.5  0.0017 3.6E-08   48.6   2.2   26   80-105   272-297 (349)
 30 PRK00175 metX homoserine O-ace  96.5  0.0012 2.6E-08   50.1   1.4   28   78-105   300-327 (379)
 31 PRK00870 haloalkane dehalogena  96.5  0.0019   4E-08   47.1   2.1   24   81-104   233-256 (302)
 32 KOG1552 Predicted alpha/beta h  96.4  0.0014 2.9E-08   47.9   1.2   29   80-110   185-213 (258)
 33 PRK10749 lysophospholipase L2;  96.1  0.0028 6.1E-08   47.1   1.5   25   81-105   253-277 (330)
 34 TIGR01392 homoserO_Ac_trn homo  96.1  0.0031 6.7E-08   47.2   1.5   27   79-105   280-306 (351)
 35 PLN02965 Probable pheophorbida  96.0  0.0046 9.9E-08   43.9   2.0   23   82-104   188-210 (255)
 36 PLN02652 hydrolase; alpha/beta  95.8   0.006 1.3E-07   47.0   2.1   26   80-105   317-342 (395)
 37 COG2267 PldB Lysophospholipase  95.6   0.046   1E-06   40.5   6.2   24   81-104   222-246 (298)
 38 PRK06765 homoserine O-acetyltr  95.6  0.0059 1.3E-07   47.0   1.4   28   78-105   314-341 (389)
 39 PRK10673 acyl-CoA esterase; Pr  95.5  0.0091   2E-07   41.8   2.2   23   82-104   190-212 (255)
 40 PRK10985 putative hydrolase; P  95.5  0.0088 1.9E-07   44.4   2.2   25   80-104   248-272 (324)
 41 PRK08775 homoserine O-acetyltr  95.3  0.0091   2E-07   44.5   1.6   23   82-104   272-294 (343)
 42 PLN03084 alpha/beta hydrolase   95.0   0.014 2.9E-07   44.9   1.9   21   84-104   322-342 (383)
 43 PRK07868 acyl-CoA synthetase;   94.6   0.016 3.5E-07   49.2   1.5   24   82-105   292-315 (994)
 44 TIGR01249 pro_imino_pep_1 prol  94.5   0.026 5.7E-07   41.3   2.2   25   81-105   241-266 (306)
 45 PRK10566 esterase; Provisional  94.5   0.012 2.5E-07   41.5   0.2   25   81-105   179-204 (249)
 46 COG1647 Esterase/lipase [Gener  94.4   0.029 6.2E-07   40.5   2.1   25   81-105   175-199 (243)
 47 PRK05855 short chain dehydroge  94.2   0.028   6E-07   44.1   1.7   23   83-105   229-251 (582)
 48 PLN02894 hydrolase, alpha/beta  94.1    0.04 8.7E-07   42.4   2.5   25   78-102   316-340 (402)
 49 PF00561 Abhydrolase_1:  alpha/  94.0   0.028   6E-07   38.2   1.2   25   80-104   168-192 (230)
 50 PRK13604 luxD acyl transferase  93.9   0.015 3.2E-07   43.6  -0.3   25   81-105   196-220 (307)
 51 TIGR01836 PHA_synth_III_C poly  92.8   0.059 1.3E-06   40.3   1.5   24   82-105   281-304 (350)
 52 KOG4178 Soluble epoxide hydrol  92.8   0.076 1.6E-06   40.1   2.0   24   81-104   252-275 (322)
 53 PF00326 Peptidase_S9:  Prolyl   92.5   0.031 6.8E-07   38.6  -0.3   20   86-105   143-162 (213)
 54 KOG1455 Lysophospholipase [Lip  92.4   0.098 2.1E-06   39.2   2.2   27   78-104   237-263 (313)
 55 COG0429 Predicted hydrolase of  92.2    0.11 2.4E-06   39.4   2.3   24   81-104   268-291 (345)
 56 COG1506 DAP2 Dipeptidyl aminop  92.2   0.051 1.1E-06   44.1   0.5   24   82-105   546-569 (620)
 57 KOG4409 Predicted hydrolase/ac  91.9     0.4 8.6E-06   36.8   4.9   45   58-103   270-318 (365)
 58 TIGR01838 PHA_synth_I poly(R)-  91.9    0.12 2.6E-06   41.5   2.3   24   81-104   409-432 (532)
 59 PF12695 Abhydrolase_5:  Alpha/  91.7   0.084 1.8E-06   33.6   1.0   25   80-104    97-121 (145)
 60 PLN02211 methyl indole-3-aceta  91.5    0.11 2.4E-06   37.6   1.6   22   83-104   206-228 (273)
 61 TIGR03100 hydr1_PEP hydrolase,  90.8   0.069 1.5E-06   38.7  -0.0   23   80-102   200-222 (274)
 62 TIGR01607 PST-A Plasmodium sub  89.6    0.19   4E-06   37.6   1.4   24   82-105   263-288 (332)
 63 PF01738 DLH:  Dienelactone hyd  88.9    0.21 4.6E-06   34.6   1.2   24   81-104   139-162 (218)
 64 PF03959 FSH1:  Serine hydrolas  88.9    0.26 5.6E-06   34.5   1.6   21   83-103   157-177 (212)
 65 COG0596 MhpC Predicted hydrola  88.7    0.39 8.5E-06   31.9   2.4   24   80-103   214-237 (282)
 66 KOG4667 Predicted esterase [Li  85.9    0.43 9.4E-06   34.6   1.4   20   86-105   198-217 (269)
 67 PF05728 UPF0227:  Uncharacteri  85.7    0.54 1.2E-05   32.7   1.7   22   87-108   134-155 (187)
 68 PRK11460 putative hydrolase; P  85.5    0.55 1.2E-05   33.3   1.8   21   85-105   146-166 (232)
 69 COG0400 Predicted esterase [Ge  85.1    0.22 4.7E-06   35.3  -0.5   19   87-105   146-164 (207)
 70 PF06342 DUF1057:  Alpha/beta h  85.1     4.9 0.00011   30.1   6.5   43   60-102   183-227 (297)
 71 PF08386 Abhydrolase_4:  TAP-li  84.9    0.25 5.5E-06   30.9  -0.2   21   85-105    32-52  (103)
 72 PLN02965 Probable pheophorbida  83.2     1.5 3.3E-05   30.9   3.2   23    2-24     61-84  (255)
 73 PF02230 Abhydrolase_2:  Phosph  82.8    0.94   2E-05   31.5   2.0   18   87-104   155-172 (216)
 74 TIGR01840 esterase_phb esteras  82.6       1 2.2E-05   31.1   2.1   21   85-105   166-186 (212)
 75 PF08840 BAAT_C:  BAAT / Acyl-C  81.8    0.67 1.5E-05   32.6   0.9   21   83-103   111-131 (213)
 76 PRK00870 haloalkane dehalogena  81.7     1.9   4E-05   31.3   3.2   23    2-24    105-127 (302)
 77 PF11339 DUF3141:  Protein of u  81.1     1.1 2.4E-05   36.2   2.0   28   81-108   291-318 (581)
 78 PF01674 Lipase_2:  Lipase (cla  79.9     2.1 4.6E-05   30.5   3.0   28    1-28     61-91  (219)
 79 PLN02872 triacylglycerol lipas  79.9     1.4   3E-05   34.1   2.1   22   83-104   319-342 (395)
 80 KOG3043 Predicted hydrolase re  77.5     1.5 3.2E-05   31.8   1.5   26   80-105   157-182 (242)
 81 PLN02442 S-formylglutathione h  75.6     2.7 5.8E-05   30.7   2.5   21   83-103   213-233 (283)
 82 TIGR01839 PHA_synth_II poly(R)  75.3     1.7 3.6E-05   35.4   1.5   24   82-105   436-459 (560)
 83 COG1073 Hydrolases of the alph  74.4       2 4.3E-05   30.1   1.6   25   81-105   225-250 (299)
 84 PRK10673 acyl-CoA esterase; Pr  74.2     3.4 7.4E-05   28.6   2.7   20    2-21     71-90  (255)
 85 PLN02211 methyl indole-3-aceta  74.2     4.4 9.6E-05   29.2   3.4   24    2-25     76-100 (273)
 86 COG0412 Dienelactone hydrolase  74.1     2.7 5.8E-05   30.1   2.2   22   83-104   154-175 (236)
 87 PF05277 DUF726:  Protein of un  73.4     4.1 8.8E-05   31.2   3.1   24    2-25    208-233 (345)
 88 PRK08775 homoserine O-acetyltr  73.2       3 6.5E-05   31.0   2.3   20    2-21    127-147 (343)
 89 COG3571 Predicted hydrolase of  70.8     3.6 7.8E-05   28.7   2.1   22   81-102   136-157 (213)
 90 PRK05371 x-prolyl-dipeptidyl a  67.6     3.3 7.1E-05   34.9   1.6   26   80-105   448-473 (767)
 91 PF03583 LIP:  Secretory lipase  64.5     5.6 0.00012   29.3   2.2   19   87-105   219-237 (290)
 92 TIGR01392 homoserO_Ac_trn homo  63.6     6.9 0.00015   29.2   2.5   20    2-21    116-136 (351)
 93 COG3243 PhaC Poly(3-hydroxyalk  63.3     5.2 0.00011   31.6   1.9   23   82-104   325-347 (445)
 94 PLN02733 phosphatidylcholine-s  63.0     9.3  0.0002   30.1   3.2   25    3-27    153-177 (440)
 95 PRK14747 cytochrome b6-f compl  62.9     5.4 0.00012   19.4   1.2    8   90-97     20-27  (29)
 96 TIGR03230 lipo_lipase lipoprot  62.8       8 0.00017   30.6   2.8   27    2-28    103-135 (442)
 97 TIGR01849 PHB_depoly_PhaZ poly  62.3     2.9 6.4E-05   32.6   0.4   25   82-106   332-357 (406)
 98 PF08538 DUF1749:  Protein of u  62.3     3.9 8.4E-05   30.8   1.0   27   78-104   223-249 (303)
 99 KOG1783 Small nuclear ribonucl  60.6       8 0.00017   23.0   1.9   17    3-19      8-24  (77)
100 KOG1838 Alpha/beta hydrolase [  60.6     8.3 0.00018   30.2   2.5   26   79-104   314-339 (409)
101 CHL00009 petN cytochrome b6/f   59.9     6.6 0.00014   19.1   1.2    8   90-97     20-27  (29)
102 PRK00175 metX homoserine O-ace  58.8     9.4  0.0002   29.0   2.6   20    2-21    136-156 (379)
103 cd00707 Pancreat_lipase_like P  57.9     8.5 0.00018   28.1   2.1   27    2-28     96-128 (275)
104 PRK02529 petN cytochrome b6-f   57.7     7.4 0.00016   19.4   1.2    9   90-98     19-27  (33)
105 COG4099 Predicted peptidase [G  56.4      10 0.00022   29.0   2.3   21   87-107   315-335 (387)
106 PF05448 AXE1:  Acetyl xylan es  56.0     4.7  0.0001   30.3   0.5   26   81-106   256-281 (320)
107 PLN03084 alpha/beta hydrolase   55.0     9.5 0.00021   29.4   2.0   20    2-21    187-206 (383)
108 PLN02894 hydrolase, alpha/beta  54.6      16 0.00034   28.2   3.2   20    2-21    166-185 (402)
109 PF07819 PGAP1:  PGAP1-like pro  53.9      18 0.00039   25.7   3.2   19   10-28     83-101 (225)
110 PF10605 3HBOH:  3HB-oligomer h  53.8       9  0.0002   31.7   1.8   23   84-106   551-574 (690)
111 KOG2385 Uncharacterized conser  52.4     9.3  0.0002   31.1   1.6   19    9-27    444-462 (633)
112 PF11288 DUF3089:  Protein of u  52.4      14  0.0003   26.3   2.4   22    3-24     85-107 (207)
113 PF10503 Esterase_phd:  Esteras  50.5      13 0.00028   26.6   2.0   18   88-105   170-187 (220)
114 PF05990 DUF900:  Alpha/beta hy  50.0      21 0.00045   25.5   3.1   27    2-28     79-109 (233)
115 KOG2551 Phospholipase/carboxyh  49.8      12 0.00025   27.1   1.7   23   82-104   158-180 (230)
116 TIGR01249 pro_imino_pep_1 prol  49.7      20 0.00043   26.1   3.0   20    2-21     85-104 (306)
117 PRK10115 protease 2; Provision  49.3      13 0.00028   30.9   2.1   24   82-105   600-624 (686)
118 PF06500 DUF1100:  Alpha/beta h  47.2      15 0.00033   28.8   2.1   24   82-105   345-370 (411)
119 PRK10749 lysophospholipase L2;  46.8      28 0.00061   25.7   3.4   25    2-26    117-145 (330)
120 TIGR02821 fghA_ester_D S-formy  46.1      18 0.00038   26.1   2.2   18   86-103   210-227 (275)
121 KOG4391 Predicted alpha/beta h  44.1      20 0.00043   26.3   2.2   24   81-104   215-238 (300)
122 PRK06765 homoserine O-acetyltr  44.0      19 0.00041   27.8   2.2   20    2-21    150-170 (389)
123 TIGR03101 hydr2_PEP hydrolase,  42.9      32 0.00069   25.2   3.1   23    4-26     91-113 (266)
124 PF02450 LCAT:  Lecithin:choles  42.8      22 0.00048   27.3   2.4   17   11-27    118-134 (389)
125 KOG2369 Lecithin:cholesterol a  39.0      27 0.00059   27.9   2.4   16    9-24    179-194 (473)
126 PF03096 Ndr:  Ndr family;  Int  37.8      81  0.0018   23.6   4.6   25   77-101   209-233 (283)
127 TIGR03131 malonate_mdcH malona  37.0      38 0.00083   24.6   2.8   27    2-28     66-92  (295)
128 PF00698 Acyl_transf_1:  Acyl t  36.6      27 0.00059   25.7   2.0   27    2-28     74-100 (318)
129 PF00151 Lipase:  Lipase;  Inte  36.6      44 0.00095   25.3   3.1   27    2-28    134-166 (331)
130 KOG2382 Predicted alpha/beta h  36.4      33 0.00072   26.0   2.4   21   84-104   250-270 (315)
131 KOG2112 Lysophospholipase [Lip  36.4      16 0.00034   26.1   0.6   18   87-104   144-161 (206)
132 PRK10162 acetyl esterase; Prov  35.9     8.7 0.00019   28.5  -0.8   16   88-103   249-264 (318)
133 KOG2624 Triglyceride lipase-ch  34.1      23 0.00051   27.7   1.3   23   82-104   327-349 (403)
134 PF06057 VirJ:  Bacterial virul  33.6      55  0.0012   23.1   3.0   24   79-102   130-154 (192)
135 PRK05855 short chain dehydroge  33.2      57  0.0012   25.5   3.4   22    2-23     83-105 (582)
136 KOG2931 Differentiation-relate  30.0 2.5E+02  0.0055   21.4   6.4   17   85-101   244-260 (326)
137 smart00827 PKS_AT Acyl transfe  28.0      64  0.0014   23.2   2.7   27    2-28     72-98  (298)
138 PLN02517 phosphatidylcholine-s  27.0      58  0.0013   27.1   2.5   17   11-27    212-228 (642)
139 cd00741 Lipase Lipase.  Lipase  26.9      85  0.0018   20.2   2.9   18   11-28     27-44  (153)
140 PF05057 DUF676:  Putative seri  26.4      54  0.0012   22.9   2.0   23   83-105   191-213 (217)
141 COG2272 PnbA Carboxylesterase   26.1 3.6E+02  0.0078   21.9   6.7   23    2-24    168-192 (491)
142 PF03742 PetN:  PetN ;  InterPr  23.3     7.4 0.00016   18.9  -2.0    7   91-97     21-27  (29)
143 TIGR00128 fabD malonyl CoA-acy  22.9      90   0.002   22.3   2.7   26    3-28     73-99  (290)
144 PRK04940 hypothetical protein;  22.9      68  0.0015   22.3   1.9   18   90-107   127-144 (180)
145 PF01764 Lipase_3:  Lipase (cla  21.4 1.3E+02  0.0028   18.8   2.9   18   11-28     63-80  (140)
146 COG3458 Acetyl esterase (deace  21.3      53  0.0012   24.8   1.2   28   81-108   253-280 (321)
147 KOG2564 Predicted acetyltransf  21.1      97  0.0021   23.6   2.5   15   12-26    146-160 (343)

No 1  
>PLN02824 hydrolase, alpha/beta fold family protein
Probab=98.89  E-value=5.3e-09  Score=75.88  Aligned_cols=28  Identities=39%  Similarity=1.062  Sum_probs=23.9

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ...+.+.++++|||+|||++|+++|.+.
T Consensus       225 ~~~~~l~~i~~P~lvi~G~~D~~~~~~~  252 (294)
T PLN02824        225 LPEELLPAVKCPVLIAWGEKDPWEPVEL  252 (294)
T ss_pred             chHHHHhhcCCCeEEEEecCCCCCChHH
Confidence            3456789999999999999999999854


No 2  
>PLN02679 hydrolase, alpha/beta fold family protein
Probab=98.86  E-value=1.4e-08  Score=76.43  Aligned_cols=43  Identities=81%  Similarity=1.530  Sum_probs=30.6

Q ss_pred             hHHHHHHHhhcCCCCCChhhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           62 GALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        62 ~a~~a~~~~~~~~~~~~~~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      +...++.+++.........+.+.+|++|||++||++|+++|++
T Consensus       267 ~~~~~~~~~~~~~~~~~~~~~l~~i~~PtLii~G~~D~~~p~~  309 (360)
T PLN02679        267 GALDAFVSIVTGPPGPNPIKLIPRISLPILVLWGDQDPFTPLD  309 (360)
T ss_pred             ChHHHHHHHHhcCCCCCHHHHhhhcCCCEEEEEeCCCCCcCch
Confidence            3444555544432333445678999999999999999999986


No 3  
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=98.64  E-value=1.4e-08  Score=76.01  Aligned_cols=46  Identities=35%  Similarity=0.577  Sum_probs=34.1

Q ss_pred             ChhHHHHHHHhhcCCCC--CChhhcCCCCC-CCeEEEecCCCCCCCCCC
Q 044687           60 DEGALDAFVSIVTGPSG--PNPVQLMPSIS-IPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        60 ~~~a~~a~~~~~~~~~~--~~~~~~l~~i~-~PtLliWG~~D~~iP~~~  105 (111)
                      ...+++++.+++....+  ....+.+.++. ||+||+||++|+++|.+.
T Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~pvlii~G~~D~~~p~~~  282 (326)
T KOG1454|consen  234 EHFHRDARLSLFLELLGFDENLLSLIKKIWKCPVLIIWGDKDQIVPLEL  282 (326)
T ss_pred             cchhhhheeeEEEeccCccchHHHhhccccCCceEEEEcCcCCccCHHH
Confidence            33566666666655444  45556788888 999999999999999863


No 4  
>PLN02578 hydrolase
Probab=98.58  E-value=1.5e-07  Score=70.64  Aligned_cols=47  Identities=28%  Similarity=0.531  Sum_probs=32.6

Q ss_pred             CChhHHHHHHHhhcC----CCCCChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           59 NDEGALDAFVSIVTG----PSGPNPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        59 ~~~~a~~a~~~~~~~----~~~~~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+++..+++..+++.    .......+.+.++++|||+|||++|+++|.+.
T Consensus       264 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~PvLiI~G~~D~~v~~~~  314 (354)
T PLN02578        264 ADPNAGEVYYRLMSRFLFNQSRYTLDSLLSKLSCPLLLLWGDLDPWVGPAK  314 (354)
T ss_pred             cCCchHHHHHHHHHHHhcCCCCCCHHHHhhcCCCCEEEEEeCCCCCCCHHH
Confidence            445555555544332    22334567899999999999999999998753


No 5  
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase. This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid.
Probab=98.29  E-value=5.1e-07  Score=65.00  Aligned_cols=25  Identities=44%  Similarity=0.731  Sum_probs=22.3

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +.+.++++|||++||++|+++|++.
T Consensus       201 ~~l~~i~~P~lii~G~~D~~v~~~~  225 (276)
T TIGR02240       201 HWLHKIQQPTLVLAGDDDPIIPLIN  225 (276)
T ss_pred             hHhhcCCCCEEEEEeCCCCcCCHHH
Confidence            5578999999999999999999854


No 6  
>PRK03592 haloalkane dehalogenase; Provisional
Probab=98.22  E-value=5.6e-06  Score=60.05  Aligned_cols=23  Identities=13%  Similarity=0.304  Sum_probs=20.3

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPL  103 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~  103 (111)
                      +.+.++++|||+|||++|+++++
T Consensus       222 ~~l~~i~~P~lii~G~~D~~~~~  244 (295)
T PRK03592        222 QWLATSDVPKLLINAEPGAILTT  244 (295)
T ss_pred             HHhccCCCCeEEEeccCCcccCc
Confidence            45788999999999999999954


No 7  
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Probab=98.02  E-value=5.3e-05  Score=54.12  Aligned_cols=27  Identities=37%  Similarity=0.703  Sum_probs=23.4

Q ss_pred             hhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           79 PVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        79 ~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ..+.+.++++|||++||++|+++|++.
T Consensus       215 ~~~~l~~i~~Pvlli~G~~D~~v~~~~  241 (282)
T TIGR03343       215 VTARLGEIKAKTLVTWGRDDRFVPLDH  241 (282)
T ss_pred             HHHHHhhCCCCEEEEEccCCCcCCchh
Confidence            446688999999999999999999754


No 8  
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional
Probab=97.94  E-value=0.00017  Score=50.41  Aligned_cols=24  Identities=17%  Similarity=0.340  Sum_probs=20.5

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFT  101 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~i  101 (111)
                      ...+.+.++++|||++||++|+.+
T Consensus       179 ~~~~~l~~i~~P~lii~G~~D~~~  202 (242)
T PRK11126        179 DLRPALQALTFPFYYLCGERDSKF  202 (242)
T ss_pred             cHHHHhhccCCCeEEEEeCCcchH
Confidence            455678999999999999999865


No 9  
>PRK07581 hypothetical protein; Validated
Probab=97.91  E-value=5.6e-05  Score=56.08  Aligned_cols=27  Identities=19%  Similarity=0.230  Sum_probs=23.7

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      ...+.+.+|++|||+|||++|..+|++
T Consensus       266 d~~~~L~~I~~PtLvI~G~~D~~~p~~  292 (339)
T PRK07581        266 DLAAALGSITAKTFVMPISTDLYFPPE  292 (339)
T ss_pred             CHHHHHhcCCCCEEEEEeCCCCCCCHH
Confidence            455778999999999999999999974


No 10 
>KOG2984 consensus Predicted hydrolase [General function prediction only]
Probab=97.86  E-value=3.8e-05  Score=54.68  Aligned_cols=43  Identities=21%  Similarity=0.321  Sum_probs=32.6

Q ss_pred             HHHHHHHhhcCCCCCChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           63 ALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        63 a~~a~~~~~~~~~~~~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +.++...|-+...+.-.+..+++++|||||++|+.|++++-.+
T Consensus       192 wvD~v~qf~~~~dG~fCr~~lp~vkcPtli~hG~kDp~~~~~h  234 (277)
T KOG2984|consen  192 WVDVVDQFHSFCDGRFCRLVLPQVKCPTLIMHGGKDPFCGDPH  234 (277)
T ss_pred             HHHHHHHHhhcCCCchHhhhcccccCCeeEeeCCcCCCCCCCC
Confidence            4444445554455666778899999999999999999998654


No 11 
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional
Probab=97.79  E-value=2.3e-05  Score=61.69  Aligned_cols=25  Identities=16%  Similarity=0.445  Sum_probs=21.4

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +.+.+|++|||++||++|.++|++.
T Consensus       412 ~l~~~I~vPtLII~Ge~D~ivP~~~  436 (481)
T PLN03087        412 HVRDQLKCDVAIFHGGDDELIPVEC  436 (481)
T ss_pred             HHHHhCCCCEEEEEECCCCCCCHHH
Confidence            4455899999999999999999864


No 12 
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein. Members of this family belong to the alpha/beta fold family hydrolases (PFAM model pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity.
Probab=97.69  E-value=0.00022  Score=50.41  Aligned_cols=25  Identities=36%  Similarity=0.643  Sum_probs=21.8

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.+.++++|+|++||++|..+|.+
T Consensus       213 ~~~~~~i~~P~lii~g~~D~~vp~~  237 (278)
T TIGR03056       213 NRDLPRITIPLHLIAGEEDKAVPPD  237 (278)
T ss_pred             hhhcccCCCCEEEEEeCCCcccCHH
Confidence            3457889999999999999999874


No 13 
>PRK03204 haloalkane dehalogenase; Provisional
Probab=97.52  E-value=0.00037  Score=50.73  Aligned_cols=21  Identities=19%  Similarity=0.194  Sum_probs=17.6

Q ss_pred             HHHHHHHhcCCCEEEEecCch
Q 044687            2 ILDFLDEVVRKPTVLIGIGDD   22 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~~   22 (111)
                      +.+++++...+++++||+|++
T Consensus        91 ~~~~~~~~~~~~~~lvG~S~G  111 (286)
T PRK03204         91 IGEFVDHLGLDRYLSMGQDWG  111 (286)
T ss_pred             HHHHHHHhCCCCEEEEEECcc
Confidence            567788888899999999883


No 14 
>TIGR03611 RutD pyrimidine utilization protein D. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the hydrolase, alpha/beta fold family defined by pfam00067.
Probab=97.46  E-value=0.00017  Score=49.88  Aligned_cols=27  Identities=22%  Similarity=0.383  Sum_probs=23.0

Q ss_pred             hhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           79 PVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        79 ~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ..+.+.++++|+|++||++|+++|.+.
T Consensus       190 ~~~~~~~i~~P~l~i~g~~D~~~~~~~  216 (257)
T TIGR03611       190 VSARLDRIQHPVLLIANRDDMLVPYTQ  216 (257)
T ss_pred             cHHHhcccCccEEEEecCcCcccCHHH
Confidence            345688999999999999999999754


No 15 
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate.
Probab=97.45  E-value=0.0013  Score=44.95  Aligned_cols=27  Identities=30%  Similarity=0.443  Sum_probs=23.0

Q ss_pred             hhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           79 PVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        79 ~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ..+.+.++++|+|+++|++|+++|.+.
T Consensus       185 ~~~~~~~~~~Pvlii~g~~D~~~~~~~  211 (251)
T TIGR02427       185 FRDRLGAIAVPTLCIAGDQDGSTPPEL  211 (251)
T ss_pred             HHHHhhhcCCCeEEEEeccCCcCChHH
Confidence            445678899999999999999999753


No 16 
>PF12697 Abhydrolase_6:  Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A ....
Probab=97.38  E-value=8.2e-06  Score=54.97  Aligned_cols=26  Identities=38%  Similarity=0.869  Sum_probs=21.9

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPL  103 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~  103 (111)
                      ...+.++++++|+++++|++|.++|.
T Consensus       167 ~~~~~~~~~~~pvl~i~g~~D~~~~~  192 (228)
T PF12697_consen  167 DLSEALPRIKVPVLVIHGEDDPIVPP  192 (228)
T ss_dssp             HHHHHHHGSSSEEEEEEETTSSSSHH
T ss_pred             cccccccccCCCeEEeecCCCCCCCH
Confidence            34466788899999999999999884


No 17 
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional
Probab=97.37  E-value=0.00039  Score=51.65  Aligned_cols=28  Identities=36%  Similarity=0.799  Sum_probs=23.4

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ...+.+.++++|||++||++|.++|.+.
T Consensus       305 ~~~~~l~~i~~Pvlii~g~~D~~vp~~~  332 (371)
T PRK14875        305 DLRDRLASLAIPVLVIWGEQDRIIPAAH  332 (371)
T ss_pred             hHHHHHhcCCCCEEEEEECCCCccCHHH
Confidence            3445678899999999999999999754


No 18 
>PRK05077 frsA fermentation/respiration switch protein; Reviewed
Probab=97.28  E-value=0.00041  Score=53.58  Aligned_cols=22  Identities=27%  Similarity=0.530  Sum_probs=20.2

Q ss_pred             CCCCCCeEEEecCCCCCCCCCC
Q 044687           84 PSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        84 ~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .++++|+|++||++|+++|+++
T Consensus       352 ~~i~~PvLiI~G~~D~ivP~~~  373 (414)
T PRK05077        352 RRCPTPMLSGYWKNDPFSPEED  373 (414)
T ss_pred             cCCCCcEEEEecCCCCCCCHHH
Confidence            5799999999999999999865


No 19 
>PRK06489 hypothetical protein; Provisional
Probab=97.15  E-value=0.00029  Score=52.98  Aligned_cols=28  Identities=29%  Similarity=0.457  Sum_probs=24.6

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +..+.+.+|++|||+|||++|.++|++.
T Consensus       283 d~~~~L~~I~~PvLvI~G~~D~~~p~~~  310 (360)
T PRK06489        283 NPSPDLEKIKAPVLAINSADDERNPPET  310 (360)
T ss_pred             ChHHHHHhCCCCEEEEecCCCcccChhh
Confidence            4567789999999999999999999864


No 20 
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase
Probab=97.13  E-value=0.0044  Score=43.31  Aligned_cols=22  Identities=27%  Similarity=0.504  Sum_probs=18.8

Q ss_pred             hhcCCCCCCCeEEEecCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFT  101 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~i  101 (111)
                      .+.+.++++|+|+++|++|++.
T Consensus       224 ~~~l~~i~~P~lii~G~~D~~~  245 (288)
T TIGR01250       224 TDKLSEIKVPTLLTVGEFDTMT  245 (288)
T ss_pred             HHHhhccCCCEEEEecCCCccC
Confidence            3567889999999999999864


No 21 
>PHA02857 monoglyceride lipase; Provisional
Probab=97.04  E-value=0.00019  Score=51.39  Aligned_cols=26  Identities=23%  Similarity=0.608  Sum_probs=23.1

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+.+.++++|||++||++|.++|++.
T Consensus       202 ~~~l~~i~~Pvliv~G~~D~i~~~~~  227 (276)
T PHA02857        202 RKIIPKIKTPILILQGTNNEISDVSG  227 (276)
T ss_pred             HHhcccCCCCEEEEecCCCCcCChHH
Confidence            45688999999999999999999864


No 22 
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding  / thiamin pyrophosphate binding
Probab=96.94  E-value=0.0028  Score=56.46  Aligned_cols=25  Identities=16%  Similarity=0.223  Sum_probs=21.7

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTP  102 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP  102 (111)
                      +..+.+.++++|||+|||++|.++|
T Consensus      1559 dl~~~L~~I~~PtLlI~Ge~D~~~~ 1583 (1655)
T PLN02980       1559 SLWEDLKQCDTPLLLVVGEKDVKFK 1583 (1655)
T ss_pred             hHHHHHhhCCCCEEEEEECCCCccH
Confidence            4557799999999999999999875


No 23 
>PRK10349 carboxylesterase BioH; Provisional
Probab=96.86  E-value=0.00043  Score=48.99  Aligned_cols=27  Identities=30%  Similarity=0.487  Sum_probs=23.5

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      +..+.+.++++|||++||++|+++|.+
T Consensus       187 ~~~~~l~~i~~P~lii~G~~D~~~~~~  213 (256)
T PRK10349        187 DLRQPLQNVSMPFLRLYGYLDGLVPRK  213 (256)
T ss_pred             ccHHHHhhcCCCeEEEecCCCccCCHH
Confidence            445678899999999999999999875


No 24 
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase.
Probab=96.86  E-value=0.0045  Score=42.04  Aligned_cols=25  Identities=28%  Similarity=0.401  Sum_probs=20.2

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTP  102 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP  102 (111)
                      ...+.+.++++|+|++||++|..++
T Consensus       185 ~~~~~~~~~~~P~l~i~g~~D~~~~  209 (251)
T TIGR03695       185 SLWPKLQALTIPVLYLCGEKDEKFV  209 (251)
T ss_pred             chHHHhhCCCCceEEEeeCcchHHH
Confidence            3445678899999999999998654


No 25 
>PRK11071 esterase YqiA; Provisional
Probab=96.81  E-value=0.00025  Score=49.12  Aligned_cols=27  Identities=15%  Similarity=0.010  Sum_probs=21.2

Q ss_pred             HHHHHHHhcCCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVVRKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~~~~v~~l   28 (111)
                      +.+++++...+++++||+|++..+...
T Consensus        51 l~~l~~~~~~~~~~lvG~S~Gg~~a~~   77 (190)
T PRK11071         51 LESLVLEHGGDPLGLVGSSLGGYYATW   77 (190)
T ss_pred             HHHHHHHcCCCCeEEEEECHHHHHHHH
Confidence            567777777899999999997665554


No 26 
>PLN02298 hydrolase, alpha/beta fold family protein
Probab=96.79  E-value=0.00035  Score=51.56  Aligned_cols=26  Identities=35%  Similarity=0.482  Sum_probs=23.0

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+.+.++++|||++||++|+++|++.
T Consensus       244 ~~~l~~i~~PvLii~G~~D~ivp~~~  269 (330)
T PLN02298        244 GKKLKDVSIPFIVLHGSADVVTDPDV  269 (330)
T ss_pred             HHhhhhcCCCEEEEecCCCCCCCHHH
Confidence            45688999999999999999999864


No 27 
>PLN02511 hydrolase
Probab=96.63  E-value=0.0015  Score=49.88  Aligned_cols=26  Identities=19%  Similarity=0.502  Sum_probs=22.9

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+.+++|++|||+|||++|+++|.+.
T Consensus       291 ~~~L~~I~vPtLiI~g~dDpi~p~~~  316 (388)
T PLN02511        291 SDSIKHVRVPLLCIQAANDPIAPARG  316 (388)
T ss_pred             hhhhccCCCCeEEEEcCCCCcCCccc
Confidence            35688999999999999999999753


No 28 
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH. This CoA-binding enzyme is required for the production of pimeloyl-coenzyme A, the substrate of the BioF protein early in the biosynthesis of biotin. Its exact function is unknown, but is proposed in ref 2. This enzyme belongs to the alpha/beta hydrolase fold family (pfam model pfam00561). Members of this family are restricted to the Proteobacteria.
Probab=96.54  E-value=0.0016  Score=44.44  Aligned_cols=28  Identities=32%  Similarity=0.476  Sum_probs=23.4

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +..+.+.++++|||++||++|+++|.+.
T Consensus       179 ~~~~~l~~i~~Pvlii~g~~D~~~~~~~  206 (245)
T TIGR01738       179 DLRQPLQNISVPFLRLYGYLDGLVPAKV  206 (245)
T ss_pred             cHHHHHhcCCCCEEEEeecCCcccCHHH
Confidence            3445678999999999999999999753


No 29 
>PLN02385 hydrolase; alpha/beta fold family protein
Probab=96.51  E-value=0.0017  Score=48.56  Aligned_cols=26  Identities=27%  Similarity=0.479  Sum_probs=22.8

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+.+.++++|||++||++|+++|++.
T Consensus       272 ~~~l~~i~~P~Lii~G~~D~vv~~~~  297 (349)
T PLN02385        272 EMQLEEVSLPLLILHGEADKVTDPSV  297 (349)
T ss_pred             HHhcccCCCCEEEEEeCCCCccChHH
Confidence            45688999999999999999999854


No 30 
>PRK00175 metX homoserine O-acetyltransferase; Provisional
Probab=96.49  E-value=0.0012  Score=50.11  Aligned_cols=28  Identities=21%  Similarity=0.170  Sum_probs=24.5

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ++.+.+.+|++|||+|||++|.++|++.
T Consensus       300 d~~~~l~~I~~PtLvI~G~~D~~~p~~~  327 (379)
T PRK00175        300 DLAAALARIKARFLVVSFTSDWLFPPAR  327 (379)
T ss_pred             CHHHHHhcCCCCEEEEEECCccccCHHH
Confidence            3667899999999999999999998753


No 31 
>PRK00870 haloalkane dehalogenase; Provisional
Probab=96.45  E-value=0.0019  Score=47.09  Aligned_cols=24  Identities=25%  Similarity=0.412  Sum_probs=21.3

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      +.+.++++|||+|||++|+++|.+
T Consensus       233 ~~l~~i~~P~lii~G~~D~~~~~~  256 (302)
T PRK00870        233 AVLERWDKPFLTAFSDSDPITGGG  256 (302)
T ss_pred             HhhhcCCCceEEEecCCCCcccCc
Confidence            457899999999999999999964


No 32 
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only]
Probab=96.41  E-value=0.0014  Score=47.86  Aligned_cols=29  Identities=24%  Similarity=0.613  Sum_probs=25.0

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCCcccCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDRPVGRY  110 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~~~~~~  110 (111)
                      .+.++.|+||+|+++|.+|.++|.+|  |++
T Consensus       185 i~kI~~i~~PVLiiHgtdDevv~~sH--g~~  213 (258)
T KOG1552|consen  185 IEKISKITCPVLIIHGTDDEVVDFSH--GKA  213 (258)
T ss_pred             cCcceeccCCEEEEecccCceecccc--cHH
Confidence            35688899999999999999999977  654


No 33 
>PRK10749 lysophospholipase L2; Provisional
Probab=96.11  E-value=0.0028  Score=47.06  Aligned_cols=25  Identities=20%  Similarity=0.242  Sum_probs=21.9

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +.+.++++|||++||++|+++|++.
T Consensus       253 ~~~~~i~~P~Lii~G~~D~vv~~~~  277 (330)
T PRK10749        253 AGAGDITTPLLLLQAEEERVVDNRM  277 (330)
T ss_pred             hhccCCCCCEEEEEeCCCeeeCHHH
Confidence            4578899999999999999999853


No 34 
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase. This family describes homoserine-O-acetyltransferase, an enzyme of methionine biosynthesis. This model has been rebuilt to identify sequences more broadly, including a number of sequences suggested to be homoserine O-acetyltransferase based on proximity to other Met biosynthesis genes.
Probab=96.06  E-value=0.0031  Score=47.18  Aligned_cols=27  Identities=22%  Similarity=0.232  Sum_probs=23.8

Q ss_pred             hhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           79 PVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        79 ~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ..+.+.+|++|||+|||++|.++|++.
T Consensus       280 ~~~~l~~I~~P~Lvi~G~~D~~~p~~~  306 (351)
T TIGR01392       280 LTEALSRIKAPFLVVSITSDWLFPPAE  306 (351)
T ss_pred             HHHHHhhCCCCEEEEEeCCccccCHHH
Confidence            457899999999999999999999753


No 35 
>PLN02965 Probable pheophorbidase
Probab=95.95  E-value=0.0046  Score=43.94  Aligned_cols=23  Identities=9%  Similarity=-0.015  Sum_probs=20.4

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.++++|||++||++|+++|++
T Consensus       188 ~~~~i~vP~lvi~g~~D~~~~~~  210 (255)
T PLN02965        188 NPEAEKVPRVYIKTAKDNLFDPV  210 (255)
T ss_pred             hhhcCCCCEEEEEcCCCCCCCHH
Confidence            45679999999999999999884


No 36 
>PLN02652 hydrolase; alpha/beta fold family protein
Probab=95.78  E-value=0.006  Score=46.97  Aligned_cols=26  Identities=27%  Similarity=0.410  Sum_probs=22.7

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+.+.+|++|+|++||++|.++|++.
T Consensus       317 ~~~L~~I~vPvLIi~G~~D~vvp~~~  342 (395)
T PLN02652        317 TRNFKSVTVPFMVLHGTADRVTDPLA  342 (395)
T ss_pred             HhhcccCCCCEEEEEeCCCCCCCHHH
Confidence            35678999999999999999999854


No 37 
>COG2267 PldB Lysophospholipase [Lipid metabolism]
Probab=95.61  E-value=0.046  Score=40.53  Aligned_cols=24  Identities=33%  Similarity=0.675  Sum_probs=20.2

Q ss_pred             hcCCCCCCCeEEEecCCCCCCC-CC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTP-LD  104 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP-~~  104 (111)
                      +....+++||||+.|++|++++ .+
T Consensus       222 ~~~~~~~~PvLll~g~~D~vv~~~~  246 (298)
T COG2267         222 RDAPAIALPVLLLQGGDDRVVDNVE  246 (298)
T ss_pred             hccccccCCEEEEecCCCccccCcH
Confidence            3366889999999999999998 44


No 38 
>PRK06765 homoserine O-acetyltransferase; Provisional
Probab=95.59  E-value=0.0059  Score=46.96  Aligned_cols=28  Identities=18%  Similarity=0.221  Sum_probs=24.4

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ++.+.+.+|++|||+|||++|.++|++.
T Consensus       314 dl~~~L~~I~~PtLvI~G~~D~l~p~~~  341 (389)
T PRK06765        314 SLEEALSNIEANVLMIPCKQDLLQPPRY  341 (389)
T ss_pred             CHHHHHhcCCCCEEEEEeCCCCCCCHHH
Confidence            4567889999999999999999999743


No 39 
>PRK10673 acyl-CoA esterase; Provisional
Probab=95.55  E-value=0.0091  Score=41.82  Aligned_cols=23  Identities=22%  Similarity=0.527  Sum_probs=20.2

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.++++|+|++||++|++++.+
T Consensus       190 ~~~~~~~P~l~i~G~~D~~~~~~  212 (255)
T PRK10673        190 KIPAWPHPALFIRGGNSPYVTEA  212 (255)
T ss_pred             ccCCCCCCeEEEECCCCCCCCHH
Confidence            46788999999999999998864


No 40 
>PRK10985 putative hydrolase; Provisional
Probab=95.54  E-value=0.0088  Score=44.35  Aligned_cols=25  Identities=28%  Similarity=0.659  Sum_probs=22.1

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.+.+|++|||+|||++|+++|.+
T Consensus       248 ~~~l~~i~~P~lii~g~~D~~~~~~  272 (324)
T PRK10985        248 LPLLNQIRKPTLIIHAKDDPFMTHE  272 (324)
T ss_pred             HHHHhCCCCCEEEEecCCCCCCChh
Confidence            3568899999999999999999874


No 41 
>PRK08775 homoserine O-acetyltransferase; Provisional
Probab=95.30  E-value=0.0091  Score=44.52  Aligned_cols=23  Identities=26%  Similarity=0.404  Sum_probs=20.7

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.+|++|||++||++|.++|++
T Consensus       272 ~l~~I~~PtLvi~G~~D~~~p~~  294 (343)
T PRK08775        272 DPEAIRVPTVVVAVEGDRLVPLA  294 (343)
T ss_pred             ChhcCCCCeEEEEeCCCEeeCHH
Confidence            47899999999999999999974


No 42 
>PLN03084 alpha/beta hydrolase fold protein; Provisional
Probab=95.05  E-value=0.014  Score=44.89  Aligned_cols=21  Identities=29%  Similarity=0.578  Sum_probs=18.8

Q ss_pred             CCCCCCeEEEecCCCCCCCCC
Q 044687           84 PSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        84 ~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .++++|||++||++|++++.+
T Consensus       322 ~~i~vPvLiI~G~~D~~v~~~  342 (383)
T PLN03084        322 KNWKTPITVCWGLRDRWLNYD  342 (383)
T ss_pred             ccCCCCEEEEeeCCCCCcCHH
Confidence            468999999999999999875


No 43 
>PRK07868 acyl-CoA synthetase; Validated
Probab=94.63  E-value=0.016  Score=49.24  Aligned_cols=24  Identities=25%  Similarity=0.411  Sum_probs=21.9

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+++|++|+|++||++|+++|++.
T Consensus       292 ~L~~i~~P~L~i~G~~D~ivp~~~  315 (994)
T PRK07868        292 TLADITCPVLAFVGEVDDIGQPAS  315 (994)
T ss_pred             chhhCCCCEEEEEeCCCCCCCHHH
Confidence            589999999999999999999854


No 44 
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily. This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.
Probab=94.54  E-value=0.026  Score=41.31  Aligned_cols=25  Identities=28%  Similarity=0.514  Sum_probs=20.9

Q ss_pred             hcCCCC-CCCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSI-SIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i-~~PtLliWG~~D~~iP~~~  105 (111)
                      +.+.++ ++|+|++||++|.++|.+.
T Consensus       241 ~~~~~i~~~P~lii~g~~D~~~p~~~  266 (306)
T TIGR01249       241 DNISKIRNIPTYIVHGRYDLCCPLQS  266 (306)
T ss_pred             HhhhhccCCCeEEEecCCCCCCCHHH
Confidence            456677 5999999999999999853


No 45 
>PRK10566 esterase; Provisional
Probab=94.49  E-value=0.012  Score=41.47  Aligned_cols=25  Identities=20%  Similarity=0.400  Sum_probs=20.8

Q ss_pred             hcCCCC-CCCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSI-SIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i-~~PtLliWG~~D~~iP~~~  105 (111)
                      ..+.++ ++|+|+++|++|.++|+++
T Consensus       179 ~~~~~i~~~P~Lii~G~~D~~v~~~~  204 (249)
T PRK10566        179 HQLEQLADRPLLLWHGLADDVVPAAE  204 (249)
T ss_pred             hhhhhcCCCCEEEEEcCCCCcCCHHH
Confidence            345666 7999999999999999854


No 46 
>COG1647 Esterase/lipase [General function prediction only]
Probab=94.42  E-value=0.029  Score=40.47  Aligned_cols=25  Identities=28%  Similarity=0.517  Sum_probs=22.2

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ..+..|..||+++-|++|.++|.+.
T Consensus       175 ~~~~~I~~pt~vvq~~~D~mv~~~s  199 (243)
T COG1647         175 RSLDKIYSPTLVVQGRQDEMVPAES  199 (243)
T ss_pred             hhhhhcccchhheecccCCCCCHHH
Confidence            4577899999999999999999865


No 47 
>PRK05855 short chain dehydrogenase; Validated
Probab=94.15  E-value=0.028  Score=44.07  Aligned_cols=23  Identities=17%  Similarity=0.276  Sum_probs=20.0

Q ss_pred             CCCCCCCeEEEecCCCCCCCCCC
Q 044687           83 MPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        83 l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +..+++|||++||++|+++|.+.
T Consensus       229 ~~~~~~P~lii~G~~D~~v~~~~  251 (582)
T PRK05855        229 ERYTDVPVQLIVPTGDPYVRPAL  251 (582)
T ss_pred             cCCccCceEEEEeCCCcccCHHH
Confidence            55689999999999999999753


No 48 
>PLN02894 hydrolase, alpha/beta fold family protein
Probab=94.09  E-value=0.04  Score=42.36  Aligned_cols=25  Identities=12%  Similarity=0.244  Sum_probs=20.9

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTP  102 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP  102 (111)
                      +..+.+.+|++|||++||++|.+.|
T Consensus       316 ~~~~~l~~I~vP~liI~G~~D~i~~  340 (402)
T PLN02894        316 PLLESASEWKVPTTFIYGRHDWMNY  340 (402)
T ss_pred             hHhhhcccCCCCEEEEEeCCCCCCc
Confidence            3446688999999999999998765


No 49 
>PF00561 Abhydrolase_1:  alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases.;  InterPro: IPR000073 The alpha/beta hydrolase fold [] is common to a number of hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is an alpha/beta-sheet (rather than a barrel), containing 8 strands connected by helices []. The enzymes are believed to have diverged from a common ancestor, preserving the arrangement of the catalytic residues. All have a catalytic triad, the elements of which are borne on loops, which are the best conserved structural features of the fold. Esterase (EST) from Pseudomonas putida is a member of the alpha/beta hydrolase fold superfamily of enzymes []. In most of the family members the beta-strands are parallels, but some have an inversion of the first strands, which gives it an antiparallel orientation. The catalytic triad residues are presented on loops. One of these is the nucleophile elbow and is the most conserved feature of the fold. Some other members lack one or all of the catalytic residues. Some members are therefore inactive but others are involved in surface recognition. The ESTHER database [] gathers and annotates all the published information related to gene and protein sequences of this superfamily []. This entry represents fold-1 of alpha/beta hydrolase.; PDB: 2VAT_E 2VAX_C 2VAV_H 2PSJ_A 2PSH_B 2PSE_A 2PSF_A 2PSD_A 2EDA_A 1CIJ_A ....
Probab=93.95  E-value=0.028  Score=38.22  Aligned_cols=25  Identities=32%  Similarity=0.998  Sum_probs=21.9

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      ...+.++++|+|++||++|+++|++
T Consensus       168 ~~~l~~i~~p~l~i~~~~D~~~p~~  192 (230)
T PF00561_consen  168 SPALSNIKVPTLIIWGEDDPLVPPE  192 (230)
T ss_dssp             HHHHTTTTSEEEEEEETTCSSSHHH
T ss_pred             cccccccCCCeEEEEeCCCCCCCHH
Confidence            3567789999999999999999974


No 50 
>PRK13604 luxD acyl transferase; Provisional
Probab=93.85  E-value=0.015  Score=43.64  Aligned_cols=25  Identities=16%  Similarity=0.403  Sum_probs=22.3

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +...+++.|+|+++|++|.++|+++
T Consensus       196 ~~~~~l~~PvLiIHG~~D~lVp~~~  220 (307)
T PRK13604        196 NKMKGLDIPFIAFTANNDSWVKQSE  220 (307)
T ss_pred             HHHhhcCCCEEEEEcCCCCccCHHH
Confidence            5577889999999999999999875


No 51 
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit. This model represents the PhaC subunit of a heterodimeric form of polyhydroxyalkanoic acid (PHA) synthase. Excepting the PhaC of Bacillus megaterium (which needs PhaR), all members require PhaE (TIGR01834) for activity and are designated class III. This enzyme builds ester polymers for carbon and energy storage that accumulate in inclusions, and both this enzyme and the depolymerase associate with the inclusions. Class III enzymes polymerize short-chain-length hydroxyalkanoates.
Probab=92.81  E-value=0.059  Score=40.31  Aligned_cols=24  Identities=25%  Similarity=0.607  Sum_probs=21.0

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+.++++|+|+++|++|.++|++.
T Consensus       281 ~l~~i~~Pvliv~G~~D~i~~~~~  304 (350)
T TIGR01836       281 DLKNIKMPILNIYAERDHLVPPDA  304 (350)
T ss_pred             cHHhCCCCeEEEecCCCCcCCHHH
Confidence            367899999999999999999753


No 52 
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism]
Probab=92.78  E-value=0.076  Score=40.07  Aligned_cols=24  Identities=46%  Similarity=0.935  Sum_probs=21.3

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      -.+.++++||+++||+.|++.+..
T Consensus       252 ~~~~~i~iPv~fi~G~~D~v~~~p  275 (322)
T KOG4178|consen  252 WALAKITIPVLFIWGDLDPVLPYP  275 (322)
T ss_pred             ccccccccceEEEEecCcccccch
Confidence            457899999999999999999875


No 53 
>PF00326 Peptidase_S9:  Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification.;  InterPro: IPR001375 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain covers the active site serine of the serine peptidases belonging to MEROPS peptidase family S9 (prolyl oligopeptidase family, clan SC). The protein fold of the peptidase domain for members of this family resembles that of serine carboxypeptidase D, the type example of clan SC. Examples of protein families containing this domain are:   Prolyl endopeptidase (3.4.21.26 from EC) (PE) (also called post-proline cleaving enzyme). PE is an enzyme that cleaves peptide bonds on the C-terminal side of prolyl residues. The sequence of PE has been obtained from a mammalian species (pig) and from bacteria (Flavobacterium meningosepticum and Aeromonas hydrophila); there is a high degree of sequence conservation between these sequences.  Escherichia coli protease II (3.4.21.83 from EC) (oligopeptidase B) (gene prtB) which cleaves peptide bonds on the C-terminal side of lysyl and argininyl residues. Dipeptidyl peptidase IV (3.4.14.5 from EC) (DPP IV). DPP IV is an enzyme that removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.  Saccharomyces cerevisiae (Baker's yeast) vacuolar dipeptidyl aminopeptidases A and B (DPAP A and DPAP B), encoded by the STE13 and DAP2 genes respectively. DPAP A is responsible for the proteolytic maturation of the alpha-factor precursor. Acylamino-acid-releasing enzyme (3.4.19.1 from EC) (acyl-peptide hydrolase). This enzyme catalyses the hydrolysis of the amino-terminal peptide bond of an N-acetylated protein to generate a N-acetylated amino acid and a protein with a free amino-terminus.   These proteins belong to MEROPS peptidase families S9A, S9B and S9C.; GO: 0008236 serine-type peptidase activity, 0006508 proteolysis; PDB: 2AJ8_D 1ORV_D 2AJB_C 2BUC_D 1ORW_D 2AJC_D 2AJD_C 2BUA_A 2HU8_B 3O4J_B ....
Probab=92.48  E-value=0.031  Score=38.63  Aligned_cols=20  Identities=40%  Similarity=0.803  Sum_probs=18.5

Q ss_pred             CCCCeEEEecCCCCCCCCCC
Q 044687           86 ISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        86 i~~PtLliWG~~D~~iP~~~  105 (111)
                      +++|+|+++|++|..+|+++
T Consensus       143 ~~~P~li~hG~~D~~Vp~~~  162 (213)
T PF00326_consen  143 IKPPVLIIHGENDPRVPPSQ  162 (213)
T ss_dssp             GGSEEEEEEETTBSSSTTHH
T ss_pred             CCCCEEEEccCCCCccCHHH
Confidence            88999999999999999865


No 54 
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]
Probab=92.40  E-value=0.098  Score=39.24  Aligned_cols=27  Identities=22%  Similarity=0.468  Sum_probs=24.5

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+++.+.+++.|.+|+||++|.++.++
T Consensus       237 ~le~~l~~vtvPflilHG~dD~VTDp~  263 (313)
T KOG1455|consen  237 DLEKNLNEVTVPFLILHGTDDKVTDPK  263 (313)
T ss_pred             HHHHhcccccccEEEEecCCCcccCcH
Confidence            567889999999999999999999875


No 55 
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=92.20  E-value=0.11  Score=39.44  Aligned_cols=24  Identities=38%  Similarity=0.837  Sum_probs=21.9

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+|.+|.+|||||+-.+|++++.+
T Consensus       268 ~~L~~Ir~PtLii~A~DDP~~~~~  291 (345)
T COG0429         268 PLLPKIRKPTLIINAKDDPFMPPE  291 (345)
T ss_pred             ccccccccceEEEecCCCCCCChh
Confidence            568999999999999999999973


No 56 
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]
Probab=92.18  E-value=0.051  Score=44.15  Aligned_cols=24  Identities=29%  Similarity=0.674  Sum_probs=21.5

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ...++++|+|||||++|..+|+++
T Consensus       546 ~~~~i~~P~LliHG~~D~~v~~~q  569 (620)
T COG1506         546 YADNIKTPLLLIHGEEDDRVPIEQ  569 (620)
T ss_pred             hhcccCCCEEEEeecCCccCChHH
Confidence            356899999999999999999976


No 57 
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=91.93  E-value=0.4  Score=36.76  Aligned_cols=45  Identities=20%  Similarity=0.381  Sum_probs=28.2

Q ss_pred             CCChhHHHHHHHhhcCCC--CCChhhcCCCCC--CCeEEEecCCCCCCCC
Q 044687           58 ANDEGALDAFVSIVTGPS--GPNPVQLMPSIS--IPVLVLWGDEDPFTPL  103 (111)
Q Consensus        58 ~~~~~a~~a~~~~~~~~~--~~~~~~~l~~i~--~PtLliWG~~D~~iP~  103 (111)
                      +..|-...+|-.++....  ...+.+.+..++  +||+.|+|++| |+..
T Consensus       270 ~~~psgE~~fk~l~~~~g~Ar~Pm~~r~~~l~~~~pv~fiyG~~d-WmD~  318 (365)
T KOG4409|consen  270 AQNPSGETAFKNLFEPGGWARRPMIQRLRELKKDVPVTFIYGDRD-WMDK  318 (365)
T ss_pred             CCCCcHHHHHHHHHhccchhhhhHHHHHHhhccCCCEEEEecCcc-cccc
Confidence            445555566655554432  234556666676  99999999666 6554


No 58 
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell.
Probab=91.92  E-value=0.12  Score=41.54  Aligned_cols=24  Identities=21%  Similarity=0.452  Sum_probs=21.9

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      ..+.+|++|+|+++|++|.++|.+
T Consensus       409 ~dL~~I~vPvLvV~G~~D~IvP~~  432 (532)
T TIGR01838       409 LDLSKVKVPVYIIATREDHIAPWQ  432 (532)
T ss_pred             cchhhCCCCEEEEeeCCCCcCCHH
Confidence            568999999999999999999874


No 59 
>PF12695 Abhydrolase_5:  Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A ....
Probab=91.67  E-value=0.084  Score=33.62  Aligned_cols=25  Identities=36%  Similarity=0.764  Sum_probs=20.2

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.+.+.+.|+++++|++|.++|.+
T Consensus        97 ~~~~~~~~~pv~~i~g~~D~~~~~~  121 (145)
T PF12695_consen   97 SEDLAKIRIPVLFIHGENDPLVPPE  121 (145)
T ss_dssp             CHHHTTTTSEEEEEEETT-SSSHHH
T ss_pred             hhhhhccCCcEEEEEECCCCcCCHH
Confidence            4557788899999999999999864


No 60 
>PLN02211 methyl indole-3-acetate methyltransferase
Probab=91.47  E-value=0.11  Score=37.62  Aligned_cols=22  Identities=14%  Similarity=0.152  Sum_probs=18.9

Q ss_pred             CCCC-CCCeEEEecCCCCCCCCC
Q 044687           83 MPSI-SIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        83 l~~i-~~PtLliWG~~D~~iP~~  104 (111)
                      ..++ ++|+++|+|++|+.+|++
T Consensus       206 ~~~~~~vP~l~I~g~~D~~ip~~  228 (273)
T PLN02211        206 TGDIDKVPRVYIKTLHDHVVKPE  228 (273)
T ss_pred             ccccCccceEEEEeCCCCCCCHH
Confidence            4456 789999999999999975


No 61 
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 2, TIGR03101) of the same superfamily.
Probab=90.84  E-value=0.069  Score=38.72  Aligned_cols=23  Identities=17%  Similarity=0.172  Sum_probs=19.3

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTP  102 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP  102 (111)
                      .+.+.++++|+|++||++|++.+
T Consensus       200 ~~~l~~~~~P~ll~~g~~D~~~~  222 (274)
T TIGR03100       200 KAGLERFQGPVLFILSGNDLTAQ  222 (274)
T ss_pred             HHHHHhcCCcEEEEEcCcchhHH
Confidence            34567889999999999998865


No 62 
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A). These genes are preferentially located in the subtelomeric regions of the chromosomes of both P. falciparum and P. yoelii.
Probab=89.64  E-value=0.19  Score=37.63  Aligned_cols=24  Identities=21%  Similarity=0.343  Sum_probs=19.7

Q ss_pred             cCCCC--CCCeEEEecCCCCCCCCCC
Q 044687           82 LMPSI--SIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        82 ~l~~i--~~PtLliWG~~D~~iP~~~  105 (111)
                      .+.++  ++|+|+++|++|++++++.
T Consensus       263 ~~~~i~~~~P~Lii~G~~D~vv~~~~  288 (332)
T TIGR01607       263 DIDYIPKDIPILFIHSKGDCVCSYEG  288 (332)
T ss_pred             hHhhCCCCCCEEEEEeCCCCccCHHH
Confidence            34556  7899999999999998754


No 63 
>PF01738 DLH:  Dienelactone hydrolase family;  InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway. Enzymes induced in 4-fluorobenzoate-utilizing bacteria have been classified into three groups on the basis of their specificity towards cis- and trans-dienelactone []. Some proteins contain repeated small fragments of this domain (for example rat kan-1 protein).; GO: 0016787 hydrolase activity; PDB: 1GGV_A 1ZIY_A 1ZI6_A 1ZIC_A 1ZJ5_A 1ZI8_A 1ZJ4_A 1ZI9_A 1ZIX_A 3F67_A.
Probab=88.88  E-value=0.21  Score=34.65  Aligned_cols=24  Identities=46%  Similarity=0.958  Sum_probs=16.5

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      +...++++|+|+++|++|+++|.+
T Consensus       139 ~~~~~~~~P~l~~~g~~D~~~~~~  162 (218)
T PF01738_consen  139 EDAPKIKAPVLILFGENDPFFPPE  162 (218)
T ss_dssp             HHGGG--S-EEEEEETT-TTS-HH
T ss_pred             hhhcccCCCEeecCccCCCCCChH
Confidence            457889999999999999999875


No 64 
>PF03959 FSH1:  Serine hydrolase (FSH1);  InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family. It consists of serine hydrolases of unknown specificity [, ] and includes uncharacterised proteins.; PDB: 1YCD_A.
Probab=88.87  E-value=0.26  Score=34.52  Aligned_cols=21  Identities=48%  Similarity=0.847  Sum_probs=13.6

Q ss_pred             CCCCCCCeEEEecCCCCCCCC
Q 044687           83 MPSISIPVLVLWGDEDPFTPL  103 (111)
Q Consensus        83 l~~i~~PtLliWG~~D~~iP~  103 (111)
                      -.+|++|||-|+|++|.+++.
T Consensus       157 ~~~i~iPtlHv~G~~D~~~~~  177 (212)
T PF03959_consen  157 EPKISIPTLHVIGENDPVVPP  177 (212)
T ss_dssp             -TT---EEEEEEETT-SSS-H
T ss_pred             cccCCCCeEEEEeCCCCCcch
Confidence            357899999999999999984


No 65 
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=88.71  E-value=0.39  Score=31.94  Aligned_cols=24  Identities=29%  Similarity=0.772  Sum_probs=19.9

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPL  103 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~  103 (111)
                      ...+.++++|+++++|++|.+.|.
T Consensus       214 ~~~~~~~~~P~l~i~g~~d~~~~~  237 (282)
T COG0596         214 RAALARITVPTLIIHGEDDPVVPA  237 (282)
T ss_pred             chhhccCCCCeEEEecCCCCcCCH
Confidence            345778899999999999977765


No 66 
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism]
Probab=85.94  E-value=0.43  Score=34.61  Aligned_cols=20  Identities=30%  Similarity=0.537  Sum_probs=18.2

Q ss_pred             CCCCeEEEecCCCCCCCCCC
Q 044687           86 ISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        86 i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+||||=++|.+|.++|++.
T Consensus       198 ~~C~VLTvhGs~D~IVPve~  217 (269)
T KOG4667|consen  198 KQCRVLTVHGSEDEIVPVED  217 (269)
T ss_pred             ccCceEEEeccCCceeechh
Confidence            36999999999999999976


No 67 
>PF05728 UPF0227:  Uncharacterised protein family (UPF0227);  InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO. One of the members of this family YqiA has been shown to be a esterase []. Other members, which include the Escherichia coli (strain K12) YcfP protein are uncharacterised.
Probab=85.71  E-value=0.54  Score=32.71  Aligned_cols=22  Identities=23%  Similarity=0.172  Sum_probs=18.2

Q ss_pred             CCCeEEEecCCCCCCCCCCccc
Q 044687           87 SIPVLVLWGDEDPFTPLDRPVG  108 (111)
Q Consensus        87 ~~PtLliWG~~D~~iP~~~~~~  108 (111)
                      ..+++|+.|+.|.+++.+.+.+
T Consensus       134 ~~~~lvll~~~DEvLd~~~a~~  155 (187)
T PF05728_consen  134 PERYLVLLQTGDEVLDYREAVA  155 (187)
T ss_pred             CccEEEEEecCCcccCHHHHHH
Confidence            4689999999999999865443


No 68 
>PRK11460 putative hydrolase; Provisional
Probab=85.52  E-value=0.55  Score=33.28  Aligned_cols=21  Identities=19%  Similarity=0.460  Sum_probs=18.3

Q ss_pred             CCCCCeEEEecCCCCCCCCCC
Q 044687           85 SISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        85 ~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ..+.|+++++|++|+++|.+.
T Consensus       146 ~~~~pvli~hG~~D~vvp~~~  166 (232)
T PRK11460        146 PTATTIHLIHGGEDPVIDVAH  166 (232)
T ss_pred             cCCCcEEEEecCCCCccCHHH
Confidence            457899999999999999864


No 69 
>COG0400 Predicted esterase [General function prediction only]
Probab=85.15  E-value=0.22  Score=35.32  Aligned_cols=19  Identities=42%  Similarity=0.791  Sum_probs=16.9

Q ss_pred             CCCeEEEecCCCCCCCCCC
Q 044687           87 SIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        87 ~~PtLliWG~~D~~iP~~~  105 (111)
                      ..|+++++|++|+++|...
T Consensus       146 ~~pill~hG~~Dpvvp~~~  164 (207)
T COG0400         146 GTPILLSHGTEDPVVPLAL  164 (207)
T ss_pred             CCeEEEeccCcCCccCHHH
Confidence            4799999999999999854


No 70 
>PF06342 DUF1057:  Alpha/beta hydrolase of unknown function (DUF1057);  InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold.
Probab=85.12  E-value=4.9  Score=30.14  Aligned_cols=43  Identities=21%  Similarity=0.298  Sum_probs=26.7

Q ss_pred             ChhHHHHHHHhhcCCCC--CChhhcCCCCCCCeEEEecCCCCCCC
Q 044687           60 DEGALDAFVSIVTGPSG--PNPVQLMPSISIPVLVLWGDEDPFTP  102 (111)
Q Consensus        60 ~~~a~~a~~~~~~~~~~--~~~~~~l~~i~~PtLliWG~~D~~iP  102 (111)
                      ...+..+..++.+..-.  ...-+.+++-++|+|++.|.+|..+-
T Consensus       183 GeeA~na~r~m~~~df~~q~~~I~~ln~~~ikvli~ygg~DhLIE  227 (297)
T PF06342_consen  183 GEEAINAMRSMQNCDFEEQKEYIDKLNKKPIKVLIAYGGKDHLIE  227 (297)
T ss_pred             hHHHHHHHHHHHhcCHHHHHHHHHHhccCCCcEEEEEcCcchhhH
Confidence            34455555544433211  12235577778999999999998864


No 71 
>PF08386 Abhydrolase_4:  TAP-like protein;  InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This entry represents a C-terminal domain associated with putative hydrolases and bacterial peptidases that belong to MEROPS peptidase family S33 (clan SC). They are related to a tripeptidyl aminopeptidase from Streptomyces lividans (Q54410 from SWISSPROT). A member of this family (Q6E3K7 from SWISSPROT) is thought to be involved in the C-terminal processing of propionicin F, a bacteriocidin characterised from Propionibacterium freudenreichii []. ; GO: 0008233 peptidase activity
Probab=84.88  E-value=0.25  Score=30.88  Aligned_cols=21  Identities=43%  Similarity=0.694  Sum_probs=18.2

Q ss_pred             CCCCCeEEEecCCCCCCCCCC
Q 044687           85 SISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        85 ~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +-..|+|++.|+.|+.+|.+.
T Consensus        32 ~~~~piL~l~~~~Dp~TP~~~   52 (103)
T PF08386_consen   32 PGAPPILVLGGTHDPVTPYEG   52 (103)
T ss_pred             CCCCCEEEEecCcCCCCcHHH
Confidence            346899999999999999865


No 72 
>PLN02965 Probable pheophorbidase
Probab=83.22  E-value=1.5  Score=30.90  Aligned_cols=23  Identities=13%  Similarity=0.278  Sum_probs=18.0

Q ss_pred             HHHHHHHhcC-CCEEEEecCchHH
Q 044687            2 ILDFLDEVVR-KPTVLIGIGDDWR   24 (111)
Q Consensus         2 i~~F~~~~~~-~p~~lvg~s~~~~   24 (111)
                      |.++++++.. ++++|||+|++..
T Consensus        61 l~~~l~~l~~~~~~~lvGhSmGG~   84 (255)
T PLN02965         61 LFALLSDLPPDHKVILVGHSIGGG   84 (255)
T ss_pred             HHHHHHhcCCCCCEEEEecCcchH
Confidence            6678888765 5999999998433


No 73 
>PF02230 Abhydrolase_2:  Phospholipase/Carboxylesterase;  InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases.; GO: 0016787 hydrolase activity; PDB: 3U0V_A 1AUR_A 1AUO_B 1FJ2_B 3CN9_A 3CN7_A.
Probab=82.77  E-value=0.94  Score=31.48  Aligned_cols=18  Identities=44%  Similarity=1.090  Sum_probs=14.6

Q ss_pred             CCCeEEEecCCCCCCCCC
Q 044687           87 SIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        87 ~~PtLliWG~~D~~iP~~  104 (111)
                      +.|+++++|++|+++|.+
T Consensus       155 ~~pi~~~hG~~D~vvp~~  172 (216)
T PF02230_consen  155 KTPILIIHGDEDPVVPFE  172 (216)
T ss_dssp             TS-EEEEEETT-SSSTHH
T ss_pred             CCcEEEEecCCCCcccHH
Confidence            689999999999999974


No 74 
>TIGR01840 esterase_phb esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi.
Probab=82.59  E-value=1  Score=31.15  Aligned_cols=21  Identities=19%  Similarity=0.074  Sum_probs=16.9

Q ss_pred             CCCCCeEEEecCCCCCCCCCC
Q 044687           85 SISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        85 ~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ....|++|++|++|.++|++.
T Consensus       166 ~~~p~~~i~hG~~D~vVp~~~  186 (212)
T TIGR01840       166 GPTPIMSVVHGDADYTVLPGN  186 (212)
T ss_pred             CCCCeEEEEEcCCCceeCcch
Confidence            344567899999999999965


No 75 
>PF08840 BAAT_C:  BAAT / Acyl-CoA thioester hydrolase C terminal;  InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Bile acid-CoA:amino acid N-acetyltransferase (BAAT) is involved in bile acid metabolism and may also act as an acyl-CoA thioesterase that regulates intracellular levels of free fatty acids []. This entry represents a catalytic domain is found at the C terminus of acyl-CoA thioester hydrolases and bile acid-CoA:amino acid N-acetyltransferases. ; PDB: 3K2I_B 3HLK_B.
Probab=81.83  E-value=0.67  Score=32.59  Aligned_cols=21  Identities=29%  Similarity=0.577  Sum_probs=15.1

Q ss_pred             CCCCCCCeEEEecCCCCCCCC
Q 044687           83 MPSISIPVLVLWGDEDPFTPL  103 (111)
Q Consensus        83 l~~i~~PtLliWG~~D~~iP~  103 (111)
                      +.++++|+|+|-|++|.+.|.
T Consensus       111 vE~i~~piLli~g~dD~~WpS  131 (213)
T PF08840_consen  111 VEKIKGPILLISGEDDQIWPS  131 (213)
T ss_dssp             GGG--SEEEEEEETT-SSS-H
T ss_pred             HHHcCCCEEEEEeCCCCccch
Confidence            557899999999999999875


No 76 
>PRK00870 haloalkane dehalogenase; Provisional
Probab=81.67  E-value=1.9  Score=31.27  Aligned_cols=23  Identities=4%  Similarity=-0.013  Sum_probs=18.8

Q ss_pred             HHHHHHHhcCCCEEEEecCchHH
Q 044687            2 ILDFLDEVVRKPTVLIGIGDDWR   24 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~~~~   24 (111)
                      |.+|++++..+++++||+|++..
T Consensus       105 l~~~l~~l~~~~v~lvGhS~Gg~  127 (302)
T PRK00870        105 MRSWFEQLDLTDVTLVCQDWGGL  127 (302)
T ss_pred             HHHHHHHcCCCCEEEEEEChHHH
Confidence            56788888889999999988433


No 77 
>PF11339 DUF3141:  Protein of unknown function (DUF3141);  InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria. Their function is unknown.
Probab=81.14  E-value=1.1  Score=36.20  Aligned_cols=28  Identities=21%  Similarity=0.345  Sum_probs=24.6

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCCccc
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDRPVG  108 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~~~~  108 (111)
                      -.|++|++|+.|+-|..|.++|+.++++
T Consensus       291 ~DLr~Ir~Piivfas~gDnITPP~QaL~  318 (581)
T PF11339_consen  291 VDLRNIRSPIIVFASYGDNITPPQQALN  318 (581)
T ss_pred             eehhhCCCCEEEEeccCCCCCChhHhcc
Confidence            3589999999999999999999987643


No 78 
>PF01674 Lipase_2:  Lipase (class 2);  InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []. This group of lipases has been called class 2 as they are not clearly related to other lipase families, and includes LipA and LipB from Bacillus subtilis [] and uncharacterised proteins from Caenorhabditis.; PDB: 2VTV_B 2X76_A 2X5X_A 2QXU_A 3QMM_A 1I6W_A 3D2C_J 2QXT_B 1R50_A 1T2N_A ....
Probab=79.91  E-value=2.1  Score=30.53  Aligned_cols=28  Identities=18%  Similarity=0.222  Sum_probs=20.2

Q ss_pred             CHHHHHHHhc---CCCEEEEecCchHHHHhh
Q 044687            1 LILDFLDEVV---RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         1 qi~~F~~~~~---~~p~~lvg~s~~~~v~~l   28 (111)
                      ||++|++++-   +..|.|||+|++..+++.
T Consensus        61 ~l~~fI~~Vl~~TGakVDIVgHS~G~~iaR~   91 (219)
T PF01674_consen   61 QLRAFIDAVLAYTGAKVDIVGHSMGGTIARY   91 (219)
T ss_dssp             HHHHHHHHHHHHHT--EEEEEETCHHHHHHH
T ss_pred             HHHHHHHHHHHhhCCEEEEEEcCCcCHHHHH
Confidence            5788998865   459999999996665554


No 79 
>PLN02872 triacylglycerol lipase
Probab=79.86  E-value=1.4  Score=34.09  Aligned_cols=22  Identities=23%  Similarity=0.508  Sum_probs=18.9

Q ss_pred             CCCC--CCCeEEEecCCCCCCCCC
Q 044687           83 MPSI--SIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        83 l~~i--~~PtLliWG~~D~~iP~~  104 (111)
                      +.++  ++|++++||++|.+++++
T Consensus       319 l~~i~~~~Pv~i~~G~~D~lv~~~  342 (395)
T PLN02872        319 LSLIPKSLPLWMGYGGTDGLADVT  342 (395)
T ss_pred             cccCCCCccEEEEEcCCCCCCCHH
Confidence            5677  579999999999999875


No 80 
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only]
Probab=77.49  E-value=1.5  Score=31.81  Aligned_cols=26  Identities=19%  Similarity=0.372  Sum_probs=22.4

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .+...++++|+|++-|+.|.++|++.
T Consensus       157 ~~D~~~vk~Pilfl~ae~D~~~p~~~  182 (242)
T KOG3043|consen  157 SADIANVKAPILFLFAELDEDVPPKD  182 (242)
T ss_pred             hhHHhcCCCCEEEEeecccccCCHHH
Confidence            35678899999999999999999853


No 81 
>PLN02442 S-formylglutathione hydrolase
Probab=75.56  E-value=2.7  Score=30.67  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=18.4

Q ss_pred             CCCCCCCeEEEecCCCCCCCC
Q 044687           83 MPSISIPVLVLWGDEDPFTPL  103 (111)
Q Consensus        83 l~~i~~PtLliWG~~D~~iP~  103 (111)
                      +...++|+++++|++|.++|.
T Consensus       213 ~~~~~~pvli~~G~~D~~v~~  233 (283)
T PLN02442        213 FNDVSATILIDQGEADKFLKE  233 (283)
T ss_pred             ccccCCCEEEEECCCCccccc
Confidence            456789999999999999886


No 82 
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II. This model represents the class II subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs, typically with six to fourteen carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell.
Probab=75.32  E-value=1.7  Score=35.35  Aligned_cols=24  Identities=21%  Similarity=0.328  Sum_probs=21.7

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .|++|+||++++-|++|.++|.+.
T Consensus       436 dL~~I~~Pvl~va~~~DHIvPw~s  459 (560)
T TIGR01839       436 DLKKVKCDSFSVAGTNDHITPWDA  459 (560)
T ss_pred             chhcCCCCeEEEecCcCCcCCHHH
Confidence            488999999999999999999853


No 83 
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only]
Probab=74.39  E-value=2  Score=30.10  Aligned_cols=25  Identities=36%  Similarity=0.566  Sum_probs=20.3

Q ss_pred             hcCCCCC-CCeEEEecCCCCCCCCCC
Q 044687           81 QLMPSIS-IPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        81 ~~l~~i~-~PtLliWG~~D~~iP~~~  105 (111)
                      ..+.++. +|+|+++|++|..+|.+.
T Consensus       225 ~~~~~i~~~P~l~~~G~~D~~vp~~~  250 (299)
T COG1073         225 DDAEKISPRPVLLVHGERDEVVPLRD  250 (299)
T ss_pred             hhHhhcCCcceEEEecCCCcccchhh
Confidence            3455666 799999999999999865


No 84 
>PRK10673 acyl-CoA esterase; Provisional
Probab=74.25  E-value=3.4  Score=28.63  Aligned_cols=20  Identities=30%  Similarity=0.416  Sum_probs=17.1

Q ss_pred             HHHHHHHhcCCCEEEEecCc
Q 044687            2 ILDFLDEVVRKPTVLIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~   21 (111)
                      +.++++++..++++|||+|+
T Consensus        71 ~~~~l~~l~~~~~~lvGhS~   90 (255)
T PRK10673         71 LLDTLDALQIEKATFIGHSM   90 (255)
T ss_pred             HHHHHHHcCCCceEEEEECH
Confidence            56788888889999999988


No 85 
>PLN02211 methyl indole-3-acetate methyltransferase
Probab=74.18  E-value=4.4  Score=29.24  Aligned_cols=24  Identities=21%  Similarity=0.414  Sum_probs=17.9

Q ss_pred             HHHHHHHhc-CCCEEEEecCchHHH
Q 044687            2 ILDFLDEVV-RKPTVLIGIGDDWRI   25 (111)
Q Consensus         2 i~~F~~~~~-~~p~~lvg~s~~~~v   25 (111)
                      |.+++++.. +++++|||+|++..+
T Consensus        76 l~~~i~~l~~~~~v~lvGhS~GG~v  100 (273)
T PLN02211         76 LIDFLSSLPENEKVILVGHSAGGLS  100 (273)
T ss_pred             HHHHHHhcCCCCCEEEEEECchHHH
Confidence            567777764 589999999994443


No 86 
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=74.14  E-value=2.7  Score=30.14  Aligned_cols=22  Identities=41%  Similarity=0.841  Sum_probs=19.9

Q ss_pred             CCCCCCCeEEEecCCCCCCCCC
Q 044687           83 MPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        83 l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      -.++++|+|+.+|++|..+|.+
T Consensus       154 ~~~~~~pvl~~~~~~D~~~p~~  175 (236)
T COG0412         154 APKIKVPVLLHLAGEDPYIPAA  175 (236)
T ss_pred             cccccCcEEEEecccCCCCChh
Confidence            4589999999999999999975


No 87 
>PF05277 DUF726:  Protein of unknown function (DUF726);  InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins.
Probab=73.38  E-value=4.1  Score=31.19  Aligned_cols=24  Identities=25%  Similarity=0.304  Sum_probs=17.7

Q ss_pred             HHHHHHHh--cCCCEEEEecCchHHH
Q 044687            2 ILDFLDEV--VRKPTVLIGIGDDWRI   25 (111)
Q Consensus         2 i~~F~~~~--~~~p~~lvg~s~~~~v   25 (111)
                      ++|.+.+.  +.+||.|||+|++.|+
T Consensus       208 LA~~L~~~~~G~RpVtLvG~SLGarv  233 (345)
T PF05277_consen  208 LADALLSRNQGERPVTLVGHSLGARV  233 (345)
T ss_pred             HHHHHHHhcCCCCceEEEeecccHHH
Confidence            45556554  5689999999997664


No 88 
>PRK08775 homoserine O-acetyltransferase; Provisional
Probab=73.16  E-value=3  Score=31.03  Aligned_cols=20  Identities=20%  Similarity=0.213  Sum_probs=16.5

Q ss_pred             HHHHHHHhcCCC-EEEEecCc
Q 044687            2 ILDFLDEVVRKP-TVLIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p-~~lvg~s~   21 (111)
                      +.+|++++..++ ++|||+|+
T Consensus       127 l~~ll~~l~l~~~~~lvG~Sm  147 (343)
T PRK08775        127 IALLLDALGIARLHAFVGYSY  147 (343)
T ss_pred             HHHHHHHcCCCcceEEEEECH
Confidence            678999988765 57999988


No 89 
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=70.79  E-value=3.6  Score=28.70  Aligned_cols=22  Identities=23%  Similarity=0.505  Sum_probs=18.9

Q ss_pred             hcCCCCCCCeEEEecCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTP  102 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP  102 (111)
                      +-|..++.||||+.|..|.+=.
T Consensus       136 ~HL~gl~tPtli~qGtrD~fGt  157 (213)
T COG3571         136 EHLTGLKTPTLITQGTRDEFGT  157 (213)
T ss_pred             hhccCCCCCeEEeecccccccC
Confidence            5688999999999999998643


No 90 
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional
Probab=67.57  E-value=3.3  Score=34.86  Aligned_cols=26  Identities=23%  Similarity=0.165  Sum_probs=22.0

Q ss_pred             hhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           80 VQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        80 ~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ...+.+|++|+|+++|.+|..+++++
T Consensus       448 ~~~~~kIkvPvLlIhGw~D~~V~~~~  473 (767)
T PRK05371        448 LKDADKIKASVLVVHGLNDWNVKPKQ  473 (767)
T ss_pred             hhHhhCCCCCEEEEeeCCCCCCChHH
Confidence            35577999999999999999998654


No 91 
>PF03583 LIP:  Secretory lipase ;  InterPro: IPR005152 This entry represents a family of secreted lipases. Family members include the LIP lipases from Candida albicans, which are expressed and secreted during the infection cycle of these pathogens [].; GO: 0004806 triglyceride lipase activity, 0016042 lipid catabolic process
Probab=64.50  E-value=5.6  Score=29.35  Aligned_cols=19  Identities=32%  Similarity=0.625  Sum_probs=17.1

Q ss_pred             CCCeEEEecCCCCCCCCCC
Q 044687           87 SIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        87 ~~PtLliWG~~D~~iP~~~  105 (111)
                      +.|++|.+|..|.++|...
T Consensus       219 ~~Pv~i~~g~~D~vvP~~~  237 (290)
T PF03583_consen  219 TVPVLIYQGTADEVVPPAD  237 (290)
T ss_pred             CCCEEEEecCCCCCCChHH
Confidence            6899999999999999853


No 92 
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase. This family describes homoserine-O-acetyltransferase, an enzyme of methionine biosynthesis. This model has been rebuilt to identify sequences more broadly, including a number of sequences suggested to be homoserine O-acetyltransferase based on proximity to other Met biosynthesis genes.
Probab=63.56  E-value=6.9  Score=29.18  Aligned_cols=20  Identities=15%  Similarity=0.091  Sum_probs=16.5

Q ss_pred             HHHHHHHhcCCC-EEEEecCc
Q 044687            2 ILDFLDEVVRKP-TVLIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p-~~lvg~s~   21 (111)
                      +.++++++..++ ++|||+|+
T Consensus       116 ~~~~~~~l~~~~~~~l~G~S~  136 (351)
T TIGR01392       116 QKLLLDHLGIEQIAAVVGGSM  136 (351)
T ss_pred             HHHHHHHcCCCCceEEEEECH
Confidence            457788887787 99999988


No 93 
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism]
Probab=63.29  E-value=5.2  Score=31.58  Aligned_cols=23  Identities=30%  Similarity=0.446  Sum_probs=20.9

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .|.+|+||++.+-|++|.+.|.+
T Consensus       325 dL~~It~pvy~~a~~~DhI~P~~  347 (445)
T COG3243         325 DLGDITCPVYNLAAEEDHIAPWS  347 (445)
T ss_pred             chhhcccceEEEeecccccCCHH
Confidence            37899999999999999999875


No 94 
>PLN02733 phosphatidylcholine-sterol O-acyltransferase
Probab=63.01  E-value=9.3  Score=30.14  Aligned_cols=25  Identities=8%  Similarity=-0.154  Sum_probs=17.1

Q ss_pred             HHHHHHhcCCCEEEEecCchHHHHh
Q 044687            3 LDFLDEVVRKPTVLIGIGDDWRIKL   27 (111)
Q Consensus         3 ~~F~~~~~~~p~~lvg~s~~~~v~~   27 (111)
                      .++.++..++||+|||||++..+..
T Consensus       153 e~~~~~~g~~kV~LVGHSMGGlva~  177 (440)
T PLN02733        153 ETVYKASGGKKVNIISHSMGGLLVK  177 (440)
T ss_pred             HHHHHHcCCCCEEEEEECHhHHHHH
Confidence            3444455678999999999554433


No 95 
>PRK14747 cytochrome b6-f complex subunit PetN; Provisional
Probab=62.86  E-value=5.4  Score=19.35  Aligned_cols=8  Identities=38%  Similarity=1.228  Sum_probs=6.5

Q ss_pred             eEEEecCC
Q 044687           90 VLVLWGDE   97 (111)
Q Consensus        90 tLliWG~~   97 (111)
                      .|++||++
T Consensus        20 slVVWGRn   27 (29)
T PRK14747         20 AMVVWGRN   27 (29)
T ss_pred             eEEEEecC
Confidence            58999975


No 96 
>TIGR03230 lipo_lipase lipoprotein lipase. Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
Probab=62.81  E-value=8  Score=30.58  Aligned_cols=27  Identities=11%  Similarity=0.156  Sum_probs=19.3

Q ss_pred             HHHHHHHhc------CCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVV------RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~------~~p~~lvg~s~~~~v~~l   28 (111)
                      |++|++.+.      .+.++|||+|++..+...
T Consensus       103 la~lI~~L~~~~gl~l~~VhLIGHSLGAhIAg~  135 (442)
T TIGR03230       103 VAKFVNWMQEEFNYPWDNVHLLGYSLGAHVAGI  135 (442)
T ss_pred             HHHHHHHHHHhhCCCCCcEEEEEECHHHHHHHH
Confidence            567777653      489999999996555443


No 97 
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some
Probab=62.31  E-value=2.9  Score=32.63  Aligned_cols=25  Identities=20%  Similarity=0.349  Sum_probs=21.9

Q ss_pred             cCCCCC-CCeEEEecCCCCCCCCCCc
Q 044687           82 LMPSIS-IPVLVLWGDEDPFTPLDRP  106 (111)
Q Consensus        82 ~l~~i~-~PtLliWG~~D~~iP~~~~  106 (111)
                      .+++|+ +|+|.+=|++|.++|++..
T Consensus       332 dl~~I~~~pll~V~ge~D~I~p~~qt  357 (406)
T TIGR01849       332 DPGAITRVALLTVEGENDDISGLGQT  357 (406)
T ss_pred             cHHHCcccceEEEeccCCCcCCHHHh
Confidence            377999 9999999999999998653


No 98 
>PF08538 DUF1749:  Protein of unknown function (DUF1749);  InterPro: IPR013744 This is a plant and fungal family of unknown function. This family contains many hypothetical proteins. ; PDB: 2Q0X_B.
Probab=62.29  E-value=3.9  Score=30.78  Aligned_cols=27  Identities=26%  Similarity=0.443  Sum_probs=14.6

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.+.++.|.+|+|++.+.+|..+|..
T Consensus       223 ~l~~tfG~v~~plLvl~Sg~DEyvP~~  249 (303)
T PF08538_consen  223 RLKKTFGKVSKPLLVLYSGKDEYVPPW  249 (303)
T ss_dssp             HHHHTGGG--S-EEEEEE--TT-----
T ss_pred             HHHHHhccCCCceEEEecCCCceeccc
Confidence            455678899999999999999999974


No 99 
>KOG1783 consensus Small nuclear ribonucleoprotein F [RNA processing and modification]
Probab=60.56  E-value=8  Score=23.00  Aligned_cols=17  Identities=18%  Similarity=0.270  Sum_probs=14.0

Q ss_pred             HHHHHHhcCCCEEEEec
Q 044687            3 LDFLDEVVRKPTVLIGI   19 (111)
Q Consensus         3 ~~F~~~~~~~p~~lvg~   19 (111)
                      .+|+.+++|+||.+==+
T Consensus         8 ~~fl~~iiGr~V~VKl~   24 (77)
T KOG1783|consen    8 GEFLKAIIGRTVVVKLN   24 (77)
T ss_pred             HHHHHHHhCCeEEEEec
Confidence            68999999999887543


No 100
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only]
Probab=60.56  E-value=8.3  Score=30.25  Aligned_cols=26  Identities=23%  Similarity=0.561  Sum_probs=22.8

Q ss_pred             hhhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           79 PVQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        79 ~~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      ....+.+|++|+|.|.-.+|+++|.+
T Consensus       314 s~~~v~~I~VP~L~ina~DDPv~p~~  339 (409)
T KOG1838|consen  314 SSNYVDKIKVPLLCINAADDPVVPEE  339 (409)
T ss_pred             hhhhcccccccEEEEecCCCCCCCcc
Confidence            34668899999999999999999984


No 101
>CHL00009 petN cytochrome b6/f complex subunit VIII
Probab=59.91  E-value=6.6  Score=19.08  Aligned_cols=8  Identities=50%  Similarity=1.203  Sum_probs=6.5

Q ss_pred             eEEEecCC
Q 044687           90 VLVLWGDE   97 (111)
Q Consensus        90 tLliWG~~   97 (111)
                      .|++||++
T Consensus        20 slVVWGR~   27 (29)
T CHL00009         20 SLVVWGRS   27 (29)
T ss_pred             EEEEEecc
Confidence            58999975


No 102
>PRK00175 metX homoserine O-acetyltransferase; Provisional
Probab=58.83  E-value=9.4  Score=28.96  Aligned_cols=20  Identities=15%  Similarity=0.130  Sum_probs=17.1

Q ss_pred             HHHHHHHhcCCC-EEEEecCc
Q 044687            2 ILDFLDEVVRKP-TVLIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p-~~lvg~s~   21 (111)
                      +.+|++++..++ ++|||+|+
T Consensus       136 ~~~~l~~l~~~~~~~lvG~S~  156 (379)
T PRK00175        136 QARLLDALGITRLAAVVGGSM  156 (379)
T ss_pred             HHHHHHHhCCCCceEEEEECH
Confidence            578899988888 59999988


No 103
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation .  The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=57.90  E-value=8.5  Score=28.07  Aligned_cols=27  Identities=26%  Similarity=0.266  Sum_probs=18.9

Q ss_pred             HHHHHHHhc------CCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVV------RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~------~~p~~lvg~s~~~~v~~l   28 (111)
                      +.+|++.+.      .++++|||+|++..+...
T Consensus        96 la~~l~~L~~~~g~~~~~i~lIGhSlGa~vAg~  128 (275)
T cd00707          96 LAKFLDFLVDNTGLSLENVHLIGHSLGAHVAGF  128 (275)
T ss_pred             HHHHHHHHHHhcCCChHHEEEEEecHHHHHHHH
Confidence            456666653      368999999996665554


No 104
>PRK02529 petN cytochrome b6-f complex subunit PetN; Provisional
Probab=57.69  E-value=7.4  Score=19.42  Aligned_cols=9  Identities=33%  Similarity=1.095  Sum_probs=7.0

Q ss_pred             eEEEecCCC
Q 044687           90 VLVLWGDED   98 (111)
Q Consensus        90 tLliWG~~D   98 (111)
                      .|++||++-
T Consensus        19 slVVWGRnG   27 (33)
T PRK02529         19 AMVVWGRNG   27 (33)
T ss_pred             EEEEEecCC
Confidence            589999763


No 105
>COG4099 Predicted peptidase [General function prediction only]
Probab=56.39  E-value=10  Score=29.00  Aligned_cols=21  Identities=19%  Similarity=0.472  Sum_probs=18.4

Q ss_pred             CCCeEEEecCCCCCCCCCCcc
Q 044687           87 SIPVLVLWGDEDPFTPLDRPV  107 (111)
Q Consensus        87 ~~PtLliWG~~D~~iP~~~~~  107 (111)
                      +.|..++++.+|+++|++.+.
T Consensus       315 ~~piWvfhs~dDkv~Pv~nSr  335 (387)
T COG4099         315 KAPIWVFHSSDDKVIPVSNSR  335 (387)
T ss_pred             cCceEEEEecCCCccccCcce
Confidence            479999999999999998754


No 106
>PF05448 AXE1:  Acetyl xylan esterase (AXE1);  InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyse the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan [].; PDB: 1VLQ_H 3M81_E 3M82_D 3M83_C 3FCY_A 1ODS_F 1ODT_C 1L7A_A 3FYT_A 2XLB_F ....
Probab=56.00  E-value=4.7  Score=30.29  Aligned_cols=26  Identities=31%  Similarity=0.461  Sum_probs=18.1

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCCc
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDRP  106 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~~  106 (111)
                      ..-++|++|+++-+|=.|++.|++..
T Consensus       256 nfA~ri~~pvl~~~gl~D~~cPP~t~  281 (320)
T PF05448_consen  256 NFARRIKCPVLFSVGLQDPVCPPSTQ  281 (320)
T ss_dssp             HHGGG--SEEEEEEETT-SSS-HHHH
T ss_pred             HHHHHcCCCEEEEEecCCCCCCchhH
Confidence            34568899999999999999998643


No 107
>PLN03084 alpha/beta hydrolase fold protein; Provisional
Probab=54.96  E-value=9.5  Score=29.36  Aligned_cols=20  Identities=20%  Similarity=0.303  Sum_probs=17.8

Q ss_pred             HHHHHHHhcCCCEEEEecCc
Q 044687            2 ILDFLDEVVRKPTVLIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~   21 (111)
                      |.+|++++..++++|||+|+
T Consensus       187 l~~~i~~l~~~~~~LvG~s~  206 (383)
T PLN03084        187 LESLIDELKSDKVSLVVQGY  206 (383)
T ss_pred             HHHHHHHhCCCCceEEEECH
Confidence            67899999999999999876


No 108
>PLN02894 hydrolase, alpha/beta fold family protein
Probab=54.60  E-value=16  Score=28.17  Aligned_cols=20  Identities=10%  Similarity=0.067  Sum_probs=16.1

Q ss_pred             HHHHHHHhcCCCEEEEecCc
Q 044687            2 ILDFLDEVVRKPTVLIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~   21 (111)
                      +.+|++++..++++|+|+|+
T Consensus       166 i~~~~~~l~~~~~~lvGhS~  185 (402)
T PLN02894        166 FEEWRKAKNLSNFILLGHSF  185 (402)
T ss_pred             HHHHHHHcCCCCeEEEEECH
Confidence            34667777778999999988


No 109
>PF07819 PGAP1:  PGAP1-like protein;  InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT). This is an endoplasmic reticulum membrane protein with a catalytic serine-containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0006505 GPI anchor metabolic process, 0006886 intracellular protein transport, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=53.95  E-value=18  Score=25.67  Aligned_cols=19  Identities=11%  Similarity=0.085  Sum_probs=15.2

Q ss_pred             cCCCEEEEecCchHHHHhh
Q 044687           10 VRKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus        10 ~~~p~~lvg~s~~~~v~~l   28 (111)
                      ..+++++||||++..+.+.
T Consensus        83 ~~~~vilVgHSmGGlvar~  101 (225)
T PF07819_consen   83 PPRSVILVGHSMGGLVARS  101 (225)
T ss_pred             CCCceEEEEEchhhHHHHH
Confidence            3689999999997766664


No 110
>PF10605 3HBOH:  3HB-oligomer hydrolase (3HBOH) ;  InterPro: IPR016582 This entry represents a group of predicted D-(-)-3-hydroxybutyrate oligomer hydrolases (also known as 3HB-oligomer hydrolase), which function in the degradation of poly-3-hydroxybutyrate (PHB). These enzymes catalyse the hydrolysis of D(-)-3-hydroxybutyrate oligomers (3HB-oligomers) into 3HB-monomers [, ].; GO: 0047989 hydroxybutyrate-dimer hydrolase activity, 0019605 butyrate metabolic process, 0005615 extracellular space
Probab=53.84  E-value=9  Score=31.73  Aligned_cols=23  Identities=17%  Similarity=0.573  Sum_probs=19.7

Q ss_pred             CCC-CCCeEEEecCCCCCCCCCCc
Q 044687           84 PSI-SIPVLVLWGDEDPFTPLDRP  106 (111)
Q Consensus        84 ~~i-~~PtLliWG~~D~~iP~~~~  106 (111)
                      .+| ..|+++++|+.|-.+|+.+.
T Consensus       551 g~L~GKPaIiVhGR~DaLlPvnh~  574 (690)
T PF10605_consen  551 GNLHGKPAIIVHGRSDALLPVNHT  574 (690)
T ss_pred             CCcCCCceEEEecccceecccCCC
Confidence            356 58999999999999999764


No 111
>KOG2385 consensus Uncharacterized conserved protein [Function unknown]
Probab=52.44  E-value=9.3  Score=31.12  Aligned_cols=19  Identities=21%  Similarity=0.371  Sum_probs=15.6

Q ss_pred             hcCCCEEEEecCchHHHHh
Q 044687            9 VVRKPTVLIGIGDDWRIKL   27 (111)
Q Consensus         9 ~~~~p~~lvg~s~~~~v~~   27 (111)
                      .+.+||.|||+|++.|+--
T Consensus       444 qG~RPVTLVGFSLGARvIf  462 (633)
T KOG2385|consen  444 QGNRPVTLVGFSLGARVIF  462 (633)
T ss_pred             cCCCceeEeeeccchHHHH
Confidence            4579999999999877554


No 112
>PF11288 DUF3089:  Protein of unknown function (DUF3089);  InterPro: IPR021440  This family of proteins has no known function. 
Probab=52.42  E-value=14  Score=26.27  Aligned_cols=22  Identities=18%  Similarity=0.211  Sum_probs=16.2

Q ss_pred             HHHHHHhc-CCCEEEEecCchHH
Q 044687            3 LDFLDEVV-RKPTVLIGIGDDWR   24 (111)
Q Consensus         3 ~~F~~~~~-~~p~~lvg~s~~~~   24 (111)
                      ..||+..- |+|+||+|||-+..
T Consensus        85 ~~yL~~~n~GRPfILaGHSQGs~  107 (207)
T PF11288_consen   85 DYYLANYNNGRPFILAGHSQGSM  107 (207)
T ss_pred             HHHHHhcCCCCCEEEEEeChHHH
Confidence            35777764 68999999987443


No 113
>PF10503 Esterase_phd:  Esterase PHB depolymerase
Probab=50.52  E-value=13  Score=26.58  Aligned_cols=18  Identities=22%  Similarity=0.362  Sum_probs=15.8

Q ss_pred             CCeEEEecCCCCCCCCCC
Q 044687           88 IPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        88 ~PtLliWG~~D~~iP~~~  105 (111)
                      .|++|+||+.|..+.+..
T Consensus       170 ~P~~v~hG~~D~tV~~~n  187 (220)
T PF10503_consen  170 YPRIVFHGTADTTVNPQN  187 (220)
T ss_pred             CCEEEEecCCCCccCcch
Confidence            599999999999998754


No 114
>PF05990 DUF900:  Alpha/beta hydrolase of unknown function (DUF900);  InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like.
Probab=50.03  E-value=21  Score=25.46  Aligned_cols=27  Identities=19%  Similarity=0.231  Sum_probs=20.3

Q ss_pred             HHHHHHHhc----CCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVV----RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~----~~p~~lvg~s~~~~v~~l   28 (111)
                      +.+|++++.    .+.++++||||+.++-..
T Consensus        79 l~~~L~~L~~~~~~~~I~ilaHSMG~rv~~~  109 (233)
T PF05990_consen   79 LARFLRDLARAPGIKRIHILAHSMGNRVLLE  109 (233)
T ss_pred             HHHHHHHHHhccCCceEEEEEeCchHHHHHH
Confidence            467777765    568999999998875443


No 115
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism]
Probab=49.79  E-value=12  Score=27.15  Aligned_cols=23  Identities=26%  Similarity=0.590  Sum_probs=20.3

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      ....|++|+|=|.|+.|.++|..
T Consensus       158 ~~~~i~~PSLHi~G~~D~iv~~~  180 (230)
T KOG2551|consen  158 YKRPLSTPSLHIFGETDTIVPSE  180 (230)
T ss_pred             hccCCCCCeeEEecccceeecch
Confidence            35589999999999999999975


No 116
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily. This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.
Probab=49.73  E-value=20  Score=26.06  Aligned_cols=20  Identities=15%  Similarity=0.039  Sum_probs=15.8

Q ss_pred             HHHHHHHhcCCCEEEEecCc
Q 044687            2 ILDFLDEVVRKPTVLIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~   21 (111)
                      +..+++++..+++++||+|+
T Consensus        85 l~~l~~~l~~~~~~lvG~S~  104 (306)
T TIGR01249        85 IEKLREKLGIKNWLVFGGSW  104 (306)
T ss_pred             HHHHHHHcCCCCEEEEEECH
Confidence            44567777778999999987


No 117
>PRK10115 protease 2; Provisional
Probab=49.32  E-value=13  Score=30.93  Aligned_cols=24  Identities=21%  Similarity=0.152  Sum_probs=19.2

Q ss_pred             cCCCCCCC-eEEEecCCCCCCCCCC
Q 044687           82 LMPSISIP-VLVLWGDEDPFTPLDR  105 (111)
Q Consensus        82 ~l~~i~~P-tLliWG~~D~~iP~~~  105 (111)
                      .+.+++.| +||+.|.+|.-+|+.+
T Consensus       600 ~v~~~~~P~lLi~~g~~D~RV~~~~  624 (686)
T PRK10115        600 NVTAQAYPHLLVTTGLHDSQVQYWE  624 (686)
T ss_pred             ccCccCCCceeEEecCCCCCcCchH
Confidence            35677889 5567999999999876


No 118
>PF06500 DUF1100:  Alpha/beta hydrolase of unknown function (DUF1100);  InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate []. This entry also includes 2,6-dihydropseudooxynicotine hydrolase which has a role in nicotine catabolism by cleaving a C-C bond in 2,6-dihydroxypseudooxyicotine [, ].; PDB: 3OUR_A 3MVE_B 2JBW_C.
Probab=47.24  E-value=15  Score=28.82  Aligned_cols=24  Identities=29%  Similarity=0.775  Sum_probs=17.0

Q ss_pred             cC--CCCCCCeEEEecCCCCCCCCCC
Q 044687           82 LM--PSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        82 ~l--~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      .|  .+.++|+|.+-|++|++.|.++
T Consensus       345 lL~~rr~~~plL~i~~~~D~v~P~eD  370 (411)
T PF06500_consen  345 LLSGRRCPTPLLAINGEDDPVSPIED  370 (411)
T ss_dssp             TTTSS-BSS-EEEEEETT-SSS-HHH
T ss_pred             cccCCCCCcceEEeecCCCCCCCHHH
Confidence            45  6888999999999999999754


No 119
>PRK10749 lysophospholipase L2; Provisional
Probab=46.84  E-value=28  Score=25.69  Aligned_cols=25  Identities=8%  Similarity=0.005  Sum_probs=17.3

Q ss_pred             HHHHHHHh----cCCCEEEEecCchHHHH
Q 044687            2 ILDFLDEV----VRKPTVLIGIGDDWRIK   26 (111)
Q Consensus         2 i~~F~~~~----~~~p~~lvg~s~~~~v~   26 (111)
                      +.++++.+    ...|++++|+|++..+.
T Consensus       117 ~~~~~~~~~~~~~~~~~~l~GhSmGG~ia  145 (330)
T PRK10749        117 LAAFWQQEIQPGPYRKRYALAHSMGGAIL  145 (330)
T ss_pred             HHHHHHHHHhcCCCCCeEEEEEcHHHHHH
Confidence            34566665    45799999999855544


No 120
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well.
Probab=46.12  E-value=18  Score=26.10  Aligned_cols=18  Identities=22%  Similarity=0.233  Sum_probs=16.0

Q ss_pred             CCCCeEEEecCCCCCCCC
Q 044687           86 ISIPVLVLWGDEDPFTPL  103 (111)
Q Consensus        86 i~~PtLliWG~~D~~iP~  103 (111)
                      ...|+++.+|++|+.+|.
T Consensus       210 ~~~plli~~G~~D~~v~~  227 (275)
T TIGR02821       210 RHSTILIDQGTADQFLDE  227 (275)
T ss_pred             cCCCeeEeecCCCcccCc
Confidence            467999999999999997


No 121
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only]
Probab=44.13  E-value=20  Score=26.32  Aligned_cols=24  Identities=21%  Similarity=0.354  Sum_probs=20.6

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCC
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      ..+++.+.|.|.+-|.+|.++|+-
T Consensus       215 ~ki~~~~~P~LFiSGlkDelVPP~  238 (300)
T KOG4391|consen  215 RKIGQCRMPFLFISGLKDELVPPV  238 (300)
T ss_pred             hhhccccCceEEeecCccccCCcH
Confidence            346677899999999999999984


No 122
>PRK06765 homoserine O-acetyltransferase; Provisional
Probab=44.03  E-value=19  Score=27.76  Aligned_cols=20  Identities=5%  Similarity=0.026  Sum_probs=16.4

Q ss_pred             HHHHHHHhcCCCEE-EEecCc
Q 044687            2 ILDFLDEVVRKPTV-LIGIGD   21 (111)
Q Consensus         2 i~~F~~~~~~~p~~-lvg~s~   21 (111)
                      +.++++++..++++ +||+|+
T Consensus       150 ~~~ll~~lgi~~~~~vvG~Sm  170 (389)
T PRK06765        150 QKELIKSLGIARLHAVMGPSM  170 (389)
T ss_pred             HHHHHHHcCCCCceEEEEECH
Confidence            46788888888886 999987


No 123
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 1, TIGR03100) of the same superfamily.
Probab=42.92  E-value=32  Score=25.16  Aligned_cols=23  Identities=22%  Similarity=0.193  Sum_probs=16.8

Q ss_pred             HHHHHhcCCCEEEEecCchHHHH
Q 044687            4 DFLDEVVRKPTVLIGIGDDWRIK   26 (111)
Q Consensus         4 ~F~~~~~~~p~~lvg~s~~~~v~   26 (111)
                      +++++...+|++|+|+|++..+.
T Consensus        91 ~~L~~~~~~~v~LvG~SmGG~vA  113 (266)
T TIGR03101        91 RWLIEQGHPPVTLWGLRLGALLA  113 (266)
T ss_pred             HHHHhcCCCCEEEEEECHHHHHH
Confidence            46666666899999999855443


No 124
>PF02450 LCAT:  Lecithin:cholesterol acyltransferase;  InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2.3.1.43 from EC), is involved in extracellular metabolism of plasma lipoproteins, including cholesterol. It esterifies the free cholesterol transported in plasma lipoproteins, and is activated by apolipoprotein A-I. Defects in LACT cause Norum and Fish eye diseases. This family also includes phospholipid:diacylglycerol acyltransferase (PDAT)(2.3.1.158 from EC), which is involved in triacylglycerol formation by an acyl-CoA independent pathway. The enzyme specifically transfers acyl groups from the sn-2 position of a phospholipid to diacylglycerol, thus forming an sn-1-lysophospholipid [].; GO: 0008374 O-acyltransferase activity, 0006629 lipid metabolic process
Probab=42.76  E-value=22  Score=27.32  Aligned_cols=17  Identities=24%  Similarity=0.063  Sum_probs=13.5

Q ss_pred             CCCEEEEecCchHHHHh
Q 044687           11 RKPTVLIGIGDDWRIKL   27 (111)
Q Consensus        11 ~~p~~lvg~s~~~~v~~   27 (111)
                      ++||+|||||++..+..
T Consensus       118 ~~kv~li~HSmGgl~~~  134 (389)
T PF02450_consen  118 GKKVVLIAHSMGGLVAR  134 (389)
T ss_pred             CCcEEEEEeCCCchHHH
Confidence            79999999999555444


No 125
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism]
Probab=39.00  E-value=27  Score=27.94  Aligned_cols=16  Identities=25%  Similarity=-0.060  Sum_probs=12.5

Q ss_pred             hcCCCEEEEecCchHH
Q 044687            9 VVRKPTVLIGIGDDWR   24 (111)
Q Consensus         9 ~~~~p~~lvg~s~~~~   24 (111)
                      -+++||+||+|||+..
T Consensus       179 ~G~kkVvlisHSMG~l  194 (473)
T KOG2369|consen  179 NGGKKVVLISHSMGGL  194 (473)
T ss_pred             cCCCceEEEecCCccH
Confidence            4469999999999443


No 126
>PF03096 Ndr:  Ndr family;  InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3. Their similarity was previously noted []. The precise molecular and cellular function of members of this family is still unknown, yet they are known to be involved in cellular differentiation events. The Ndr1 group was the first to be discovered. Their expression is repressed by the proto-oncogenes N-myc and c-myc, and in line with this observation, Ndr1 protein expression is down-regulated in neoplastic cells, and is reactivated when differentiation is induced by chemicals such as retinoic acid. Ndr2 and Ndr3 expression is not under the control of N-myc or c-myc. Ndr1 expression is also activated by several chemicals: tunicamycin and homocysteine induce Ndr1 in human umbilical endothelial cells; nickel induces Ndr1 in several cell types. Members of this family are found in wide variety of multicellular eukaryotes, including an Ndr1 type protein in Helianthus annuus (Common sunflower), known as Sf21. Interestingly, the highest scoring matches in the noise are all alpha/beta hydrolases (IPR000073 from INTERPRO), suggesting that this family may have an enzymatic function.; PDB: 2QMQ_A 2XMR_B 2XMQ_B 2XMS_A.
Probab=37.76  E-value=81  Score=23.57  Aligned_cols=25  Identities=32%  Similarity=0.543  Sum_probs=16.3

Q ss_pred             CChhhcCCCCCCCeEEEecCCCCCC
Q 044687           77 PNPVQLMPSISIPVLVLWGDEDPFT  101 (111)
Q Consensus        77 ~~~~~~l~~i~~PtLliWG~~D~~i  101 (111)
                      .++...+....||||++=|++.+..
T Consensus       209 ~DL~~~~~~~~c~vLlvvG~~Sp~~  233 (283)
T PF03096_consen  209 TDLSIERPSLGCPVLLVVGDNSPHV  233 (283)
T ss_dssp             ----SECTTCCS-EEEEEETTSTTH
T ss_pred             ccchhhcCCCCCCeEEEEecCCcch
Confidence            3556667888899999999887653


No 127
>TIGR03131 malonate_mdcH malonate decarboxylase, epsilon subunit. Members of this protein family are the epsilon subunit of malonate decarboxylase. This subunit has malonyl-CoA/dephospho-CoA acyltransferase activity. Malonate decarboxylase may be a soluble enzyme, or linked to membrane subunits and active as a sodium pump. The epsilon subunit is closely related to the malonyl CoA-acyl carrier protein (ACP) transacylase family described by TIGR00128, but acts on an ACP subunit of malonate decarboxylase that has an unusual coenzyme A derivative as its prothetic group.
Probab=36.97  E-value=38  Score=24.57  Aligned_cols=27  Identities=11%  Similarity=0.105  Sum_probs=21.2

Q ss_pred             HHHHHHHhcCCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVVRKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~~~~v~~l   28 (111)
                      +.+.|++.+.+|..++|+|+++..+..
T Consensus        66 l~~~l~~~g~~P~~v~GhS~GE~aAa~   92 (295)
T TIGR03131        66 AWRALLALLPRPSAVAGYSVGEYAAAV   92 (295)
T ss_pred             HHHHHHhcCCCCcEEeecCHHHHHHHH
Confidence            456678888899999999997765554


No 128
>PF00698 Acyl_transf_1:  Acyl transferase domain;  InterPro: IPR014043 Enzymes like bacterial malonyl CoA-acly carrier protein transacylase (2.3.1.39 from EC) and eukaryotic fatty acid synthase (2.3.1.85 from EC) that are involved in fatty acid biosynthesis belong to this group. Also included are the polyketide synthases 6-methylsalicylic acid synthase (2.3.1 from EC), a multifunctional enzyme that involved in the biosynthesis of patulin and conidial green pigment synthase (2.3.1 from EC).; PDB: 3HHD_C 2JFD_D 2JFK_A 3G87_A 3IM9_A 2QO3_B 3IM8_A 3EZO_A 2QJ3_A 2QC3_A ....
Probab=36.63  E-value=27  Score=25.75  Aligned_cols=27  Identities=22%  Similarity=0.187  Sum_probs=21.8

Q ss_pred             HHHHHHHhcCCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVVRKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~~~~v~~l   28 (111)
                      +.+.|++.+.+|..++|+|++|-.+..
T Consensus        74 l~~~l~~~Gi~P~~v~GhSlGE~aA~~  100 (318)
T PF00698_consen   74 LARLLRSWGIKPDAVIGHSLGEYAALV  100 (318)
T ss_dssp             HHHHHHHTTHCESEEEESTTHHHHHHH
T ss_pred             hhhhhcccccccceeeccchhhHHHHH
Confidence            456788888899999999998876554


No 129
>PF00151 Lipase:  Lipase;  InterPro: IPR013818 Triglyceride lipases (3.1.1.3 from EC) are lipolytic enzymes that hydrolyse ester linkages of triglycerides []. Lipases are widely distributed in animals, plants and prokaryotes. At least three tissue-specific isozymes exist in higher vertebrates, pancreatic, hepatic and gastric/lingual. These lipases are closely related to each other and to lipoprotein lipase (3.1.1.34 from EC), which hydrolyses triglycerides of chylomicrons and very low density lipoproteins (VLDL) []. The most conserved region in all these proteins is centred around a serine residue which has been shown [] to participate, with an histidine and an aspartic acid residue, in a charge relay system. Such a region is also present in lipases of prokaryotic origin and in lecithin-cholesterol acyltransferase (2.3.1.43 from EC) (LCAT) [], which catalyzes fatty acid transfer between phosphatidylcholine and cholesterol.; PDB: 1LPB_B 1LPA_B 1N8S_A 1GPL_A 1W52_X 2PVS_B 2OXE_B 1BU8_A 2PPL_A 1ETH_A ....
Probab=36.56  E-value=44  Score=25.29  Aligned_cols=27  Identities=19%  Similarity=0.219  Sum_probs=20.1

Q ss_pred             HHHHHHHhc------CCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVV------RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~------~~p~~lvg~s~~~~v~~l   28 (111)
                      |++||+.+.      .+-++|||+|++..+...
T Consensus       134 la~~l~~L~~~~g~~~~~ihlIGhSLGAHvaG~  166 (331)
T PF00151_consen  134 LAKFLSFLINNFGVPPENIHLIGHSLGAHVAGF  166 (331)
T ss_dssp             HHHHHHHHHHHH---GGGEEEEEETCHHHHHHH
T ss_pred             HHHHHHHHHhhcCCChhHEEEEeeccchhhhhh
Confidence            566777655      367999999997776665


No 130
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only]
Probab=36.45  E-value=33  Score=26.03  Aligned_cols=21  Identities=29%  Similarity=0.430  Sum_probs=18.9

Q ss_pred             CCCCCCeEEEecCCCCCCCCC
Q 044687           84 PSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        84 ~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .....|||.+.|.++..+|.+
T Consensus       250 ~~~~~pvlfi~g~~S~fv~~~  270 (315)
T KOG2382|consen  250 GPYTGPVLFIKGLQSKFVPDE  270 (315)
T ss_pred             cccccceeEEecCCCCCcChh
Confidence            677889999999999999976


No 131
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism]
Probab=36.37  E-value=16  Score=26.06  Aligned_cols=18  Identities=33%  Similarity=0.776  Sum_probs=16.3

Q ss_pred             CCCeEEEecCCCCCCCCC
Q 044687           87 SIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        87 ~~PtLliWG~~D~~iP~~  104 (111)
                      ..|.+..+|+.|+++|..
T Consensus       144 ~~~i~~~Hg~~d~~vp~~  161 (206)
T KOG2112|consen  144 YTPILLCHGTADPLVPFR  161 (206)
T ss_pred             cchhheecccCCceeehH
Confidence            579999999999999974


No 132
>PRK10162 acetyl esterase; Provisional
Probab=35.89  E-value=8.7  Score=28.47  Aligned_cols=16  Identities=19%  Similarity=0.262  Sum_probs=14.0

Q ss_pred             CCeEEEecCCCCCCCC
Q 044687           88 IPVLVLWGDEDPFTPL  103 (111)
Q Consensus        88 ~PtLliWG~~D~~iP~  103 (111)
                      .|++|++|+.|+..+-
T Consensus       249 Pp~~i~~g~~D~L~de  264 (318)
T PRK10162        249 PPCFIAGAEFDPLLDD  264 (318)
T ss_pred             CCeEEEecCCCcCcCh
Confidence            6999999999998754


No 133
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism]
Probab=34.07  E-value=23  Score=27.69  Aligned_cols=23  Identities=22%  Similarity=0.486  Sum_probs=19.7

Q ss_pred             cCCCCCCCeEEEecCCCCCCCCC
Q 044687           82 LMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        82 ~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      .+.+++.||.+.||++|-...++
T Consensus       327 ~l~~i~~P~~l~~g~~D~l~~~~  349 (403)
T KOG2624|consen  327 DLTNIKVPTALYYGDNDWLADPE  349 (403)
T ss_pred             CccccccCEEEEecCCcccCCHH
Confidence            46788999999999999887764


No 134
>PF06057 VirJ:  Bacterial virulence protein (VirJ);  InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins. VirJ is thought to be involved in the type IV secretion system. It is thought that the substrate proteins localised to the periplasm may associate with the pilus in a manner that is mediated by VirJ, and suggest a two-step process for type IV secretion in Agrobacterium [].
Probab=33.58  E-value=55  Score=23.08  Aligned_cols=24  Identities=13%  Similarity=0.374  Sum_probs=17.0

Q ss_pred             hhhcCCCCCC-CeEEEecCCCCCCC
Q 044687           79 PVQLMPSISI-PVLVLWGDEDPFTP  102 (111)
Q Consensus        79 ~~~~l~~i~~-PtLliWG~~D~~iP  102 (111)
                      ....+++++. |++.|.|++|.-..
T Consensus       130 ~~pei~~l~~~~v~CiyG~~E~d~~  154 (192)
T PF06057_consen  130 VIPEIAKLPPAPVQCIYGEDEDDSL  154 (192)
T ss_pred             chHHHHhCCCCeEEEEEcCCCCCCc
Confidence            3445666664 99999999887543


No 135
>PRK05855 short chain dehydrogenase; Validated
Probab=33.17  E-value=57  Score=25.51  Aligned_cols=22  Identities=18%  Similarity=0.209  Sum_probs=17.0

Q ss_pred             HHHHHHHhcC-CCEEEEecCchH
Q 044687            2 ILDFLDEVVR-KPTVLIGIGDDW   23 (111)
Q Consensus         2 i~~F~~~~~~-~p~~lvg~s~~~   23 (111)
                      +.++++.+.. +|++|||+|++.
T Consensus        83 l~~~i~~l~~~~~~~lvGhS~Gg  105 (582)
T PRK05855         83 FAAVIDAVSPDRPVHLLAHDWGS  105 (582)
T ss_pred             HHHHHHHhCCCCcEEEEecChHH
Confidence            5678888764 579999999854


No 136
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown]
Probab=29.98  E-value=2.5e+02  Score=21.44  Aligned_cols=17  Identities=35%  Similarity=0.774  Sum_probs=14.2

Q ss_pred             CCCCCeEEEecCCCCCC
Q 044687           85 SISIPVLVLWGDEDPFT  101 (111)
Q Consensus        85 ~i~~PtLliWG~~D~~i  101 (111)
                      .++||||++=|++-+..
T Consensus       244 tlkc~vllvvGd~Sp~~  260 (326)
T KOG2931|consen  244 TLKCPVLLVVGDNSPHV  260 (326)
T ss_pred             cccccEEEEecCCCchh
Confidence            67799999999887654


No 137
>smart00827 PKS_AT Acyl transferase domain in polyketide synthase (PKS) enzymes.
Probab=28.04  E-value=64  Score=23.23  Aligned_cols=27  Identities=7%  Similarity=0.024  Sum_probs=20.8

Q ss_pred             HHHHHHHhcCCCEEEEecCchHHHHhh
Q 044687            2 ILDFLDEVVRKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         2 i~~F~~~~~~~p~~lvg~s~~~~v~~l   28 (111)
                      +.+.+++.+.+|..++|+|+++-.+..
T Consensus        72 ~~~~l~~~Gi~p~~~~GhSlGE~aA~~   98 (298)
T smart00827       72 LARLWRSWGVRPDAVVGHSLGEIAAAY   98 (298)
T ss_pred             HHHHHHHcCCcccEEEecCHHHHHHHH
Confidence            345677888899999999997765544


No 138
>PLN02517 phosphatidylcholine-sterol O-acyltransferase
Probab=26.99  E-value=58  Score=27.13  Aligned_cols=17  Identities=18%  Similarity=-0.021  Sum_probs=13.1

Q ss_pred             CCCEEEEecCchHHHHh
Q 044687           11 RKPTVLIGIGDDWRIKL   27 (111)
Q Consensus        11 ~~p~~lvg~s~~~~v~~   27 (111)
                      +++|+|||||++..+..
T Consensus       212 gkKVVLV~HSMGglv~l  228 (642)
T PLN02517        212 GKKVVVVPHSMGVLYFL  228 (642)
T ss_pred             CCeEEEEEeCCchHHHH
Confidence            68999999999554433


No 139
>cd00741 Lipase Lipase.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation", the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=26.90  E-value=85  Score=20.23  Aligned_cols=18  Identities=11%  Similarity=-0.110  Sum_probs=15.4

Q ss_pred             CCCEEEEecCchHHHHhh
Q 044687           11 RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus        11 ~~p~~lvg~s~~~~v~~l   28 (111)
                      ...++++|+|++.-+..+
T Consensus        27 ~~~i~v~GHSlGg~lA~l   44 (153)
T cd00741          27 DYKIHVTGHSLGGALAGL   44 (153)
T ss_pred             CCeEEEEEcCHHHHHHHH
Confidence            678999999998877776


No 140
>PF05057 DUF676:  Putative serine esterase (DUF676);  InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases.
Probab=26.41  E-value=54  Score=22.91  Aligned_cols=23  Identities=17%  Similarity=0.198  Sum_probs=17.6

Q ss_pred             CCCCCCCeEEEecCCCCCCCCCC
Q 044687           83 MPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        83 l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      |+..+.-+|+---.+|..+|...
T Consensus       191 L~~F~~~~l~an~~~D~~V~~~s  213 (217)
T PF05057_consen  191 LKRFKRRVLYANIVNDRYVPFHS  213 (217)
T ss_pred             HHhCCCEEEEEccCCCCccceec
Confidence            56677777777788999998754


No 141
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism]
Probab=26.12  E-value=3.6e+02  Score=21.93  Aligned_cols=23  Identities=17%  Similarity=0.245  Sum_probs=18.9

Q ss_pred             HHHHHHHhcCCC--EEEEecCchHH
Q 044687            2 ILDFLDEVVRKP--TVLIGIGDDWR   24 (111)
Q Consensus         2 i~~F~~~~~~~p--~~lvg~s~~~~   24 (111)
                      |++.|+..+|.|  |.|.|.|.+..
T Consensus       168 V~~NIe~FGGDp~NVTl~GeSAGa~  192 (491)
T COG2272         168 VRDNIEAFGGDPQNVTLFGESAGAA  192 (491)
T ss_pred             HHHHHHHhCCCccceEEeeccchHH
Confidence            678999999987  99999887443


No 142
>PF03742 PetN:  PetN ;  InterPro: IPR005497 PetN is a small hydrophobic protein, crucial for cytochrome b6-f complex assembly and/or stability. It is found in bacteria and plants. Cytochrome b6-f complex is composed of 4 large subunits: cytochrome b6, subunit IV (17 kDa polypeptide, petD), cytochrome f and the Rieske protein, as well as 4 small subunits: petG, petL, petM and petN. The complex functions as a dimer. The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI) [].; GO: 0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity, 0017004 cytochrome complex assembly, 0009512 cytochrome b6f complex; PDB: 2ZT9_H 2D2C_H 2E76_H 1VF5_U 2E75_H 2E74_H.
Probab=23.26  E-value=7.4  Score=18.93  Aligned_cols=7  Identities=57%  Similarity=1.455  Sum_probs=3.4

Q ss_pred             EEEecCC
Q 044687           91 LVLWGDE   97 (111)
Q Consensus        91 LliWG~~   97 (111)
                      |++||++
T Consensus        21 lVVWGRn   27 (29)
T PF03742_consen   21 LVVWGRN   27 (29)
T ss_dssp             HHHHHCC
T ss_pred             eEEEecc
Confidence            4455543


No 143
>TIGR00128 fabD malonyl CoA-acyl carrier protein transacylase. The seed alignment for this family of proteins contains a single member each from a number of bacterial species but also an additional pair of closely related, uncharacterized proteins from B. subtilis, one of which has a long C-terminal extension.
Probab=22.89  E-value=90  Score=22.29  Aligned_cols=26  Identities=23%  Similarity=0.017  Sum_probs=19.3

Q ss_pred             HHHHHHhc-CCCEEEEecCchHHHHhh
Q 044687            3 LDFLDEVV-RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus         3 ~~F~~~~~-~~p~~lvg~s~~~~v~~l   28 (111)
                      .+.|++.+ .+|..++|+|++|..+..
T Consensus        73 ~~~l~~~g~i~p~~v~GhS~GE~aAa~   99 (290)
T TIGR00128        73 YLKLKEQGGLKPDFAAGHSLGEYSALV   99 (290)
T ss_pred             HHHHHHcCCCCCCEEeecCHHHHHHHH
Confidence            34566666 789999999997765544


No 144
>PRK04940 hypothetical protein; Provisional
Probab=22.86  E-value=68  Score=22.30  Aligned_cols=18  Identities=22%  Similarity=0.307  Sum_probs=12.7

Q ss_pred             eEEEecCCCCCCCCCCcc
Q 044687           90 VLVLWGDEDPFTPLDRPV  107 (111)
Q Consensus        90 tLliWG~~D~~iP~~~~~  107 (111)
                      .+++=.+.|.+++..+++
T Consensus       127 ~~vllq~gDEvLDyr~a~  144 (180)
T PRK04940        127 CLVILSRNDEVLDSQRTA  144 (180)
T ss_pred             EEEEEeCCCcccCHHHHH
Confidence            477778888887765544


No 145
>PF01764 Lipase_3:  Lipase (class 3);  InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides []. Lipases are widely distributed in animals, plants and prokaryotes. This family of lipases have been called Class 3 as they are not closely related to other lipase families.; GO: 0004806 triglyceride lipase activity, 0006629 lipid metabolic process; PDB: 1LGY_A 1DTE_A 1DT5_F 4DYH_B 1DU4_C 4EA6_B 1GT6_B 1EIN_A 1DT3_A 1TIB_A ....
Probab=21.42  E-value=1.3e+02  Score=18.75  Aligned_cols=18  Identities=17%  Similarity=0.069  Sum_probs=14.3

Q ss_pred             CCCEEEEecCchHHHHhh
Q 044687           11 RKPTVLIGIGDDWRIKLL   28 (111)
Q Consensus        11 ~~p~~lvg~s~~~~v~~l   28 (111)
                      ...+++.|||++.-++.+
T Consensus        63 ~~~i~itGHSLGGalA~l   80 (140)
T PF01764_consen   63 DYSIVITGHSLGGALASL   80 (140)
T ss_dssp             TSEEEEEEETHHHHHHHH
T ss_pred             CccchhhccchHHHHHHH
Confidence            356999999998876666


No 146
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=21.33  E-value=53  Score=24.83  Aligned_cols=28  Identities=32%  Similarity=0.497  Sum_probs=23.4

Q ss_pred             hcCCCCCCCeEEEecCCCCCCCCCCccc
Q 044687           81 QLMPSISIPVLVLWGDEDPFTPLDRPVG  108 (111)
Q Consensus        81 ~~l~~i~~PtLliWG~~D~~iP~~~~~~  108 (111)
                      ..-++++.|+|+.=|=-|++.|++...|
T Consensus       253 n~A~RiK~pvL~svgL~D~vcpPstqFA  280 (321)
T COG3458         253 NLAARIKVPVLMSVGLMDPVCPPSTQFA  280 (321)
T ss_pred             hHHHhhccceEEeecccCCCCCChhhHH
Confidence            3456899999999999999999976544


No 147
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]
Probab=21.08  E-value=97  Score=23.64  Aligned_cols=15  Identities=20%  Similarity=0.217  Sum_probs=11.4

Q ss_pred             CCEEEEecCchHHHH
Q 044687           12 KPTVLIGIGDDWRIK   26 (111)
Q Consensus        12 ~p~~lvg~s~~~~v~   26 (111)
                      .|++|||||++..+.
T Consensus       146 ~~iilVGHSmGGaIa  160 (343)
T KOG2564|consen  146 PQIILVGHSMGGAIA  160 (343)
T ss_pred             CceEEEeccccchhh
Confidence            679999999954433


Done!