BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044715
(202 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3UUN|A Chain A, Crystal Structure Of N-Terminal First Spectrin Repeat Of
Dystrophin
pdb|3UUN|B Chain B, Crystal Structure Of N-Terminal First Spectrin Repeat Of
Dystrophin
Length = 119
Score = 27.3 bits (59), Expect = 5.5, Method: Compositional matrix adjust.
Identities = 9/30 (30%), Positives = 21/30 (70%)
Query: 123 DEVEDVEDACRSFENYLVEMVVEEGKVGDL 152
++VE V+D + E Y++++ +G+VG++
Sbjct: 33 NDVEVVKDQFHTHEGYMMDLTAHQGRVGNI 62
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.137 0.425
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,458,726
Number of Sequences: 62578
Number of extensions: 213334
Number of successful extensions: 405
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 404
Number of HSP's gapped (non-prelim): 2
length of query: 202
length of database: 14,973,337
effective HSP length: 94
effective length of query: 108
effective length of database: 9,091,005
effective search space: 981828540
effective search space used: 981828540
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)