Citrus Sinensis ID: 044744


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MAILGISSFVINWEYESYPEARDFLALPFFAIFFPTVRLVLDKCVFENLARRLIIGKGHARINFGTQIKRQKINKFKESAWKCVYFFSAELLALVVSYDEPWFTNTKYFWEGPGNQAWPYQKTKLKLKGLYMYVGGFYAYSILALLVWETRRSDFGVSMAHHVATVILIVLSYILRFTRVGSVVLAVHDVSDIFLEVAKMSKYSGIEWIASISFIVFVCSWTVLRIIYYPFWVIWSTSYEVLLNFNKENHQMDGPICM
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccccccc
**ILGISSFVINWEYESYPEARDFLALPFFAIFFPTVRLVLDKCVFENLARRLIIGKGHARINFGTQIKRQKINKFKESAWKCVYFFSAELLALVVSYDEPWFTNTKYFWEGPGNQAWPYQKTKLKLKGLYMYVGGFYAYSILALLVWETRRSDFGVSMAHHVATVILIVLSYILRFTRVGSVVLAVHDVSDIFLEVAKMSKYSGIEWIASISFIVFVCSWTVLRIIYYPFWVIWSTSYEVLLNFNKENHQMDGPICM
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAILGISSFVINWEYESYPEARDFLALPFFAIFFPTVRLVLDKCVFENLARRLIIGKGHARINFGTQIKRQKINKFKESAWKCVYFFSAELLALVVSYDEPWFTNTKYFWEGPGNQAWPYQKTKLKLKGLYMYVGGFYAYSILALLVWETRRSDFGVSMAHHVATVILIVLSYILRFTRVGSVVLAVHDVSDIFLEVAKMSKYSGIEWIASISFIVFVCSWTVLRIIYYPFWVIWSTSYEVLLNFNKENHQMDGPICM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ASC1-like protein Mediates resistance to sphinganine-analog mycotoxins (SAMs) by restoring the sphingolipid biosynthesis. Could salvage the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus in ceramides-depleted cells after SAM exposure.probableQ8W4Y5
LAG1 longevity assurance homolog 3 Mediates resistance to sphinganine-analog mycotoxins (SAMs) by restoring the sphingolipid biosynthesis. Could salvage the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus in ceramides-depleted cells after SAM exposure.probableQ6NQI8
ASC1-like protein 1 Mediates resistance to sphinganine-analog mycotoxins (SAMs) by restoring the sphingolipid biosynthesis. Could salvage the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus in ceramides-depleted cells after SAM exposure.probableQ6EUN0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted