BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044754
         (172 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IZR|HH Chain h, Localization Of The Large Subunit Ribosomal Proteins Into
           A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s
           Ribosome
          Length = 133

 Score = 26.2 bits (56), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 6/70 (8%)

Query: 108 KAYKEYRMDDY----SSWLRKRMNDEENWRKIKSCFVATNI--CSDFERRHVNAAAADKF 161
           K +K    D Y    +SW R +  D    RK K C +  NI   SD + RH       KF
Sbjct: 16  KQFKRPHSDRYIGLKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKF 75

Query: 162 SRERLSSVEV 171
               +S +E+
Sbjct: 76  VVHNVSELEL 85


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.136    0.436 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,893,815
Number of Sequences: 62578
Number of extensions: 122932
Number of successful extensions: 265
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 265
Number of HSP's gapped (non-prelim): 1
length of query: 172
length of database: 14,973,337
effective HSP length: 92
effective length of query: 80
effective length of database: 9,216,161
effective search space: 737292880
effective search space used: 737292880
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)