BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044754
(172 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3IZR|HH Chain h, Localization Of The Large Subunit Ribosomal Proteins Into
A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s
Ribosome
Length = 133
Score = 26.2 bits (56), Expect = 9.5, Method: Compositional matrix adjust.
Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 6/70 (8%)
Query: 108 KAYKEYRMDDY----SSWLRKRMNDEENWRKIKSCFVATNI--CSDFERRHVNAAAADKF 161
K +K D Y +SW R + D RK K C + NI SD + RH KF
Sbjct: 16 KQFKRPHSDRYIGLKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKF 75
Query: 162 SRERLSSVEV 171
+S +E+
Sbjct: 76 VVHNVSELEL 85
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.136 0.436
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,893,815
Number of Sequences: 62578
Number of extensions: 122932
Number of successful extensions: 265
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 265
Number of HSP's gapped (non-prelim): 1
length of query: 172
length of database: 14,973,337
effective HSP length: 92
effective length of query: 80
effective length of database: 9,216,161
effective search space: 737292880
effective search space used: 737292880
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)