BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044763
         (453 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With
           Tetradecanoic Acid Ligated Acyl Carrier Protein
 pdb|3EJB|D Chain D, Crystal Structure Of P450bioi In Complex With
           Tetradecanoic Acid Ligated Acyl Carrier Protein
 pdb|3EJB|F Chain F, Crystal Structure Of P450bioi In Complex With
           Tetradecanoic Acid Ligated Acyl Carrier Protein
 pdb|3EJB|H Chain H, Crystal Structure Of P450bioi In Complex With
           Tetradecanoic Acid Ligated Acyl Carrier Protein
 pdb|3EJD|B Chain B, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
 pdb|3EJD|D Chain D, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
 pdb|3EJD|F Chain F, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
 pdb|3EJD|H Chain H, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
 pdb|3EJE|B Chain B, Crystal Structure Of P450bioi In Complex With Octadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
 pdb|3EJE|D Chain D, Crystal Structure Of P450bioi In Complex With Octadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
 pdb|3EJE|F Chain F, Crystal Structure Of P450bioi In Complex With Octadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
 pdb|3EJE|H Chain H, Crystal Structure Of P450bioi In Complex With Octadec-9z-
           Enoic Acid Ligated Acyl Carrier Protein
          Length = 404

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 9/61 (14%)

Query: 72  DLDRLGYEIERCSGIKYPTWKV------EAIDKIAKFWLRT---DHSYGYERLLHYKNEM 122
           D  R  + I + S +KYP W V       AI K A+F +RT   + S  Y+ L H +N+M
Sbjct: 20  DTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVRTPLPESSTKYQDLSHVQNQM 79

Query: 123 L 123
           +
Sbjct: 80  M 80


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.458 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,458,646
Number of Sequences: 62578
Number of extensions: 599237
Number of successful extensions: 1503
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1499
Number of HSP's gapped (non-prelim): 5
length of query: 453
length of database: 14,973,337
effective HSP length: 102
effective length of query: 351
effective length of database: 8,590,381
effective search space: 3015223731
effective search space used: 3015223731
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)