BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044763
(453 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With
Tetradecanoic Acid Ligated Acyl Carrier Protein
pdb|3EJB|D Chain D, Crystal Structure Of P450bioi In Complex With
Tetradecanoic Acid Ligated Acyl Carrier Protein
pdb|3EJB|F Chain F, Crystal Structure Of P450bioi In Complex With
Tetradecanoic Acid Ligated Acyl Carrier Protein
pdb|3EJB|H Chain H, Crystal Structure Of P450bioi In Complex With
Tetradecanoic Acid Ligated Acyl Carrier Protein
pdb|3EJD|B Chain B, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
pdb|3EJD|D Chain D, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
pdb|3EJD|F Chain F, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
pdb|3EJD|H Chain H, Crystal Structure Of P450bioi In Complex With Hexadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
pdb|3EJE|B Chain B, Crystal Structure Of P450bioi In Complex With Octadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
pdb|3EJE|D Chain D, Crystal Structure Of P450bioi In Complex With Octadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
pdb|3EJE|F Chain F, Crystal Structure Of P450bioi In Complex With Octadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
pdb|3EJE|H Chain H, Crystal Structure Of P450bioi In Complex With Octadec-9z-
Enoic Acid Ligated Acyl Carrier Protein
Length = 404
Score = 31.2 bits (69), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 9/61 (14%)
Query: 72 DLDRLGYEIERCSGIKYPTWKV------EAIDKIAKFWLRT---DHSYGYERLLHYKNEM 122
D R + I + S +KYP W V AI K A+F +RT + S Y+ L H +N+M
Sbjct: 20 DTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVRTPLPESSTKYQDLSHVQNQM 79
Query: 123 L 123
+
Sbjct: 80 M 80
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.137 0.458
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,458,646
Number of Sequences: 62578
Number of extensions: 599237
Number of successful extensions: 1503
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1499
Number of HSP's gapped (non-prelim): 5
length of query: 453
length of database: 14,973,337
effective HSP length: 102
effective length of query: 351
effective length of database: 8,590,381
effective search space: 3015223731
effective search space used: 3015223731
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)