Query 044831
Match_columns 77
No_of_seqs 109 out of 209
Neff 4.1
Searched_HMMs 46136
Date Fri Mar 29 07:10:30 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044831.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044831hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF01439 Metallothio_2: Metall 100.0 7.8E-36 1.7E-40 190.1 5.3 67 1-74 1-69 (74)
2 KOG4738 Predicted metallothion 93.9 0.066 1.4E-06 32.3 2.6 26 2-27 5-31 (51)
3 PF01439 Metallothio_2: Metall 92.8 0.065 1.4E-06 34.3 1.5 14 7-20 2-15 (74)
4 PF02067 Metallothio_5: Metall 89.8 0.2 4.2E-06 29.1 1.3 14 4-17 17-30 (41)
5 PF05522 Metallothio_6: Metall 82.2 0.7 1.5E-05 29.1 1.0 18 6-24 42-59 (65)
6 PF03940 MSSP: Male specific s 53.3 14 0.00029 21.9 2.1 23 2-24 4-26 (48)
7 PF01754 zf-A20: A20-like zinc 27.0 28 0.00061 17.9 0.5 11 67-77 3-13 (25)
8 PF09791 Oxidored-like: Oxidor 23.0 39 0.00084 19.7 0.6 8 16-23 19-26 (48)
9 PF12749 Metallothio_Euk: Euka 22.7 58 0.0013 20.9 1.4 10 8-17 24-35 (74)
10 PF06954 Resistin: Resistin; 22.2 21 0.00046 23.7 -0.7 9 13-21 53-61 (88)
No 1
>PF01439 Metallothio_2: Metallothionein; InterPro: IPR000347 Members of this family are metallothioneins. These proteins are cysteine rich proteins that bind to heavy metals. Members of this family appear to be closest to Class II metallothioneins.; GO: 0046872 metal ion binding
Probab=100.00 E-value=7.8e-36 Score=190.14 Aligned_cols=67 Identities=57% Similarity=0.963 Sum_probs=61.9
Q ss_pred CCc-cCCCCCCCCCCCCCCCCCCCccCCCCCCCcCCCcccccEEEeecCCccchhhhhcccC-CCCCCCCCCCCee
Q 044831 1 MSC-YGQNCGYGSSCKCGSDCNVCRMYPDLSYSESPTTTTDILVLGDVYAKMHYEVSEMGFG-AEGDCKCKFYKNF 74 (77)
Q Consensus 1 MSc-cggnCgCGs~C~CGsgCggCkmyPDl~~~E~t~~tt~tlVlGVAP~K~~~egse~~~~-~e~GCKCGsnc~~ 74 (77)
||| ||+||+|||+|+||+ ||||||+|+|++ |++||||||||+|.+||++||+++ ++||||||+||+=
T Consensus 1 MsC~CggnCgCGs~C~Cg~-----kmypdl~~~~~t--tt~t~V~GVAP~k~~~eg~E~~~~~~~~GCKCGsnC~C 69 (74)
T PF01439_consen 1 MSCGCGGNCGCGSGCKCGS-----KMYPDLEESETT--TTETLVLGVAPQKGHFEGSEMGAGAGGNGCKCGSNCTC 69 (74)
T ss_pred CCCcCCCcCCCCCCCCcCC-----ccccchhccccc--cceeEEEeeCCCcchhhhhhhhhcccCCCCCCCCCCcc
Confidence 999 999999999999998 899999987776 789999999999999999999877 5679999999974
No 2
>KOG4738 consensus Predicted metallothionein [Inorganic ion transport and metabolism]
Probab=93.89 E-value=0.066 Score=32.26 Aligned_cols=26 Identities=42% Similarity=1.019 Sum_probs=21.1
Q ss_pred CccCCCCCCCCCCCCCCC-CCCCccCC
Q 044831 2 SCYGQNCGYGSSCKCGSD-CNVCRMYP 27 (77)
Q Consensus 2 SccggnCgCGs~C~CGsg-CggCkmyP 27 (77)
.+.+++|.|||+|+|... |..|+.+.
T Consensus 5 ~~~g~~C~Cgs~CkC~~~kC~sC~k~~ 31 (51)
T KOG4738|consen 5 CCKGGSCTCGSSCKCSDCKCTSCKKSC 31 (51)
T ss_pred ccCCCccccCCccccCCCccCCcCCcc
Confidence 357899999999999987 87677654
No 3
>PF01439 Metallothio_2: Metallothionein; InterPro: IPR000347 Members of this family are metallothioneins. These proteins are cysteine rich proteins that bind to heavy metals. Members of this family appear to be closest to Class II metallothioneins.; GO: 0046872 metal ion binding
Probab=92.82 E-value=0.065 Score=34.32 Aligned_cols=14 Identities=57% Similarity=1.633 Sum_probs=13.1
Q ss_pred CCCCCCCCCCCCCC
Q 044831 7 NCGYGSSCKCGSDC 20 (77)
Q Consensus 7 nCgCGs~C~CGsgC 20 (77)
+|+||++|+|||+|
T Consensus 2 sC~CggnCgCGs~C 15 (74)
T PF01439_consen 2 SCGCGGNCGCGSGC 15 (74)
T ss_pred CCcCCCcCCCCCCC
Confidence 68999999999998
No 4
>PF02067 Metallothio_5: Metallothionein family 5; InterPro: IPR000966 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ] species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class I MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. Diptera (Drosophila, family 5) MTs are 40-43 residue proteins that contain 10 conserved cysteines arranged in five Cys-X-Cys groups. In particular, the consensus pattern C-G-x(2)-C-x-C-x(2)-Q-x(5)-C-x-C-x(2)-D-C-x-C has been found to be diagnostic of family 5 MTs. The protein is found primarily in the alimentary canal, and its induction is stimulated by ingestion of cadmium or copper []. Mercury, silver and zinc induce the protein to a lesser extent. Family 5 includes subfamilies: d1, d2. Only one d2 is known until now. Subfamilies hit the same entry.; GO: 0046872 metal ion binding
Probab=89.84 E-value=0.2 Score=29.11 Aligned_cols=14 Identities=43% Similarity=1.056 Sum_probs=9.9
Q ss_pred cCCCCCCCCCCCCC
Q 044831 4 YGQNCGYGSSCKCG 17 (77)
Q Consensus 4 cggnCgCGs~C~CG 17 (77)
||+||+|++.|+|+
T Consensus 17 cg~~C~C~~dC~C~ 30 (41)
T PF02067_consen 17 CGGNCACNQDCKCV 30 (41)
T ss_pred cCCCccCCCCcccc
Confidence 56777777777775
No 5
>PF05522 Metallothio_6: Metallothionein; InterPro: IPR017980 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs [see http://www.bioc.unizh.ch/mtpage/protali.html]. Echinoidea (sea urchin, family 4) MTs are 64-67 residue proteins. Members of this family are recognised by the sequence pattern P-D-x-K-C-[V,F]-C-C-x(5)-C-x-C-x(4)-C-C-x(4)-C-C-x(4,6)-C-C located near the N terminus. The taxonomic range of the members extends to sea urchins (echinodea). The protein sequence is divided into two structural domains, each containing 9 and 11 Cys residues binding 3 and 4 bivalent metal ions, respectively. Family 4 includes subfamilies: e1, e2, they are separate phylogenetic groups. This entry includes the sea urchin proteins, and related sequences from worms.; PDB: 1QJK_A 1QJL_A.
Probab=82.24 E-value=0.7 Score=29.13 Aligned_cols=18 Identities=44% Similarity=1.300 Sum_probs=6.5
Q ss_pred CCCCCCCCCCCCCCCCCCc
Q 044831 6 QNCGYGSSCKCGSDCNVCR 24 (77)
Q Consensus 6 gnCgCGs~C~CGsgCggCk 24 (77)
.+|.||.+|||+.++ +|+
T Consensus 42 A~CKCga~CKC~~G~-~Ct 59 (65)
T PF05522_consen 42 AACKCGAGCKCGGGC-GCT 59 (65)
T ss_dssp TT----TT--TTS-----B
T ss_pred ccccccCCceeCCCC-ccc
Confidence 678899999999987 564
No 6
>PF03940 MSSP: Male specific sperm protein; InterPro: IPR005634 This is a family of Drosophila proteins, that are typified by the repetitive motif C-G-P.
Probab=53.27 E-value=14 Score=21.93 Aligned_cols=23 Identities=35% Similarity=0.869 Sum_probs=15.9
Q ss_pred CccCCCCCCCCCCCCCCCCCCCc
Q 044831 2 SCYGQNCGYGSSCKCGSDCNVCR 24 (77)
Q Consensus 2 SccggnCgCGs~C~CGsgCggCk 24 (77)
.||+.-.+|++-..||+-||.|.
T Consensus 4 pcc~pcg~cgpc~~cgpccg~cg 26 (48)
T PF03940_consen 4 PCCGPCGGCGPCGGCGPCCGPCG 26 (48)
T ss_pred CccccccCccCcccCcCcccCcC
Confidence 46666667777667777777764
No 7
>PF01754 zf-A20: A20-like zinc finger; InterPro: IPR002653 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents the zinc finger domain found in A20. A20 is an inhibitor of cell death that inhibits NF-kappaB activation via the tumour necrosis factor receptor associated factor pathway []. The zinc finger domains appear to mediate self-association in A20. These fingers also mediate IL-1-induced NF-kappa B activation. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 2FIF_F 2FID_B 2C7N_C 2C7M_A 2L00_A 2KZY_A 2EQG_A 2EQE_A 3OJ3_J 3OJ4_C ....
Probab=26.98 E-value=28 Score=17.89 Aligned_cols=11 Identities=27% Similarity=0.329 Sum_probs=7.0
Q ss_pred CCCCCCeeccC
Q 044831 67 KCKFYKNFYLN 77 (77)
Q Consensus 67 KCGsnc~~~~~ 77 (77)
+|..+|.||.|
T Consensus 3 ~C~~gCgf~Gs 13 (25)
T PF01754_consen 3 LCANGCGFYGS 13 (25)
T ss_dssp B-TTTSSSB-B
T ss_pred cccCCCCCccc
Confidence 46788999864
No 8
>PF09791 Oxidored-like: Oxidoreductase-like protein, N-terminal; InterPro: IPR019180 This entry represents the N-terminal domain of various oxidoreductase-like proteins whose exact function is, as yet, unknown.
Probab=23.03 E-value=39 Score=19.75 Aligned_cols=8 Identities=63% Similarity=1.717 Sum_probs=5.8
Q ss_pred CCCCCCCC
Q 044831 16 CGSDCNVC 23 (77)
Q Consensus 16 CGsgCggC 23 (77)
|||||..|
T Consensus 19 CgSGC~~C 26 (48)
T PF09791_consen 19 CGSGCAPC 26 (48)
T ss_pred cccCCccc
Confidence 67777767
No 9
>PF12749 Metallothio_Euk: Eukaryotic metallothionein; InterPro: IPR024306 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs [see http://www.bioc.unizh.ch/mtpage/protali.html]. This entry represents a subgroup of eukaryotic metallothioneins which includes copper-induced metallothioneins from the protist Tetrahymena [].
Probab=22.67 E-value=58 Score=20.94 Aligned_cols=10 Identities=40% Similarity=1.361 Sum_probs=5.0
Q ss_pred CCCC--CCCCCC
Q 044831 8 CGYG--SSCKCG 17 (77)
Q Consensus 8 CgCG--s~C~CG 17 (77)
|.|| ..|+|+
T Consensus 24 CkCG~~daC~C~ 35 (74)
T PF12749_consen 24 CKCGTTDACNCQ 35 (74)
T ss_pred cccCCCCccccc
Confidence 4444 555555
No 10
>PF06954 Resistin: Resistin; InterPro: IPR009714 This family consists of several mammalian resistin proteins. Resistin is a 12.5 kDa cysteine-rich secreted polypeptide first reported from rodent adipocytes. It belongs to a multigene family termed RELMs or FIZZ proteins. Plasma resistin levels are significantly increased in both genetically susceptible and high-fat-diet-induced obese mice. Immunoneutralisation of resistin improves hyperglycemia and insulin resistance in high-fat-diet-induced obese mice, while administration of recombinant resistin impairs glucose tolerance and insulin action in normal mice. It has been demonstrated that increases in circulating resistin levels markedly stimulate glucose production in the presence of fixed physiological insulin levels, whereas insulin suppressed resistin expression. It has been suggested that resistin could be a link between obesity and type 2 diabetes [].; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1RH7_D 1RGX_C 1RFX_B.
Probab=22.20 E-value=21 Score=23.65 Aligned_cols=9 Identities=44% Similarity=1.453 Sum_probs=5.2
Q ss_pred CCCCCCCCC
Q 044831 13 SCKCGSDCN 21 (77)
Q Consensus 13 ~C~CGsgCg 21 (77)
+|.||++||
T Consensus 53 gCaCG~aCG 61 (88)
T PF06954_consen 53 GCACGYACG 61 (88)
T ss_dssp EEEESTT--
T ss_pred ccccccccc
Confidence 577777775
Done!