Citrus Sinensis ID: 044842


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600--
MGVGGKFWDLLKPYARFEGLDFLRDKRVAVDLSYWIVQHETAIKKNSVPKPHLRLTFFRTINLFAKFGAFPVFVVDGTPSPLKSQARLARFYRSTIDASTLPVAEEGILVERNQTFLKCVQECVELLELFGMPVLKAKGEAEALCAQLNSEGYVDACITADSDAFLFGAKCVVKCIRPNTKEPFECYCISDIEAGLGLKRKHLIAMSLLIGNDHDLNGVQGIGLDTALQFVQNFSEDEILNILHKIGNGDIPQYWGDIKSTEEAVSHSDESMPMIKSSHCSFCGHPGTKRAHFKFSCEYCINDNNEGCLKKPDGFKCNCSLCNKNRKEKEQKKHENWWIKVCSKIALETNFPNDEIVTMYLCENNGTFTATDGPSISWGSPMTEMLVDFLVYHQPWQPSYIRQKMLPMLSTIYLREMATNPVQTLLCGQYEFDSIRRVKIRYGHQSYVVKWKKAASAISGVKYTAPVDSDLHLEEFMEYPQIHVDGDCWFLLTDENMKLVHSAFPKKVDHFLQENERRELKRKRTSSLRSEESNGKLESPKSKGVQLSITEFYRSAKVQSQEKSGADLAKDSNCQVDRISKENRRVSSPNLSKSARRRLLFN
cccccccHHHHcccccccccccccccEEEEEHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccCEEEEEccccccccHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHcccEEEEEcccccEEcccccEEcccccccccccEEEECHHHHHHHccccHHHHHHHHHHccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHcHHHHHHcccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEccEEEEEEEEcccccccccccccccccccccHHHcccccccccccccEEEEEcccHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHccc
MGVGGKFWDLLKPYARFEGLDFLRDKRVAVDLSYWIVQHETAIKKNSVPKPHLRLTFFRTINLFAKFGAFPVFVVDGTPSPLKSQARLARFYRSTIDASTLPVAEEGILVERNQTFLKCVQECVELLELFGMPVLKAKGEAEALCAQLNSEGYVDACITADSDAFLFGAKCVVKCIRPNTKEPFECYCISDIEAGLGLKRKHLIAMSLLIGNDHDLNGVQGIGLDTALQFVQNFSEDEILNILHKIGNGDIPQYWGDIKSTEEAVSHSDESMPMIKSSHCSFCGHPGTKRAHFKFSCEYCINDNN**CLKKPDGFKCNCSLCNKNRKEKEQKKHENWWIKVCSKIALETNFPNDEIVTMYLCENNGTFTATDGPSISWGSPMTEMLVDFLVYHQPWQPSYIRQKMLPMLSTIYLREMATNPVQTLLCGQYEFDSIRRVKIRYGHQSYVVKWKKAASAISGVKYTAPVDSDLHLEEFMEYPQIHVDGDCWFLLTDENMKLVHSAFPKKVDHF*****************************************************************************************F*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVGGKFWDLLKPYARFEGLDFLRDKRVAVDLSYWIVQHETAIKKNSVPKPHLRLTFFRTINLFAKFGAFPVFVVDGTPSPLKSQARLARFYRSTIDASTLPVAEEGILVERNQTFLKCVQECVELLELFGMPVLKAKGEAEALCAQLNSEGYVDACITADSDAFLFGAKCVVKCIRPNTKEPFECYCISDIEAGLGLKRKHLIAMSLLIGNDHDLNGVQGIGLDTALQFVQNFSEDEILNILHKIGNGDIPQYWGDIKSTEEAVSHSDESMPMIKSSHCSFCGHPGTKRAHFKFSCEYCINDNNEGCLKKPDGFKCNCSLCNKNRKEKEQKKHENWWIKVCSKIALETNFPNDEIVTMYLCENNGTFTATDGPSISWGSPMTEMLVDFLVYHQPWQPSYIRQKMLPMLSTIYLREMATNPVQTLLCGQYEFDSIRRVKIRYGHQSYVVKWKKAASAISGVKYTAPVDSDLHLEEFMEYPQIHVDGDCWFLLTDENMKLVHSAFPKKVDHFLQENERRELKRKRTSSLRSEESNGKLESPKSKGVQLSITEFYRSAKVQSQEKSGADLAKDSNCQVDRISKENRRVSSPNLSKSARRRLLFN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flap endonuclease GEN-like 1 Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA.probableQ9LPD2
Flap endonuclease GEN-like 1 Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA. Possesses both single-stranded and double-stranded DNA-binding activities. Involved in early microspore development, but does not alter meiosis or tapetal cells development.probableQ64MA3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q8K, chain A
Confidence level:very confident
Coverage over the Query: 2-246,344-412
View the alignment between query and template
View the model in PyMOL
Template: 3MTS, chain A
Confidence level:probable
Coverage over the Query: 432-460,475,488-514
View the alignment between query and template
View the model in PyMOL