Citrus Sinensis ID: 044851


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MASNNQPPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECGSVEDIDESRL
cccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccccccccEEEccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEcccHHccccccHHHccHHcc
masnnqppqkqdtqpgkehvmnpipqftspdytpsnklRGMVALVtggdsgigrAVCHCFAQEGATVAftyvkpqedkDAKETLEMLREaktpdakdpmaisadlgfdenCKRVVDEVVNAYDRIDILVNNAaeqyecgsvedidesrl
masnnqppqkqdtqpgkehvMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLReaktpdakdpmaisadlgfdenCKRVVDEVVNAYDRIDILVNnaaeqyecgsvedidesrl
MASNNQPPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECGSVEDIDESRL
*************************************LRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVK****************************SADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECG**********
****NQP************VMNPIPQFT*PDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECGSVEDIDESRL
*****************EHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECGSVEDIDESRL
********************MNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECGSVEDID****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNNQPPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECGSVEDIDESRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q5KTS5 291 Glucose and ribitol dehyd N/A no 1.0 0.512 0.726 1e-60
Q9FZ42 288 Glucose and ribitol dehyd yes no 0.946 0.489 0.751 5e-60
Q9MA93 289 Glucose and ribitol dehyd no no 0.953 0.491 0.706 6e-57
Q75KH3 300 Glucose and ribitol dehyd yes no 1.0 0.496 0.662 2e-49
O07575 289 Uncharacterized oxidoredu yes no 0.946 0.487 0.414 7e-25
P80873 286 General stress protein 39 no no 0.919 0.479 0.426 1e-23
P40397 285 Uncharacterized oxidoredu no no 0.906 0.473 0.426 3e-23
P40398 299 Uncharacterized oxidoredu no no 0.885 0.441 0.350 5e-15
P0AG84 294 Uncharacterized oxidoredu N/A no 0.946 0.479 0.326 5e-14
P0AG85 294 Uncharacterized oxidoredu N/A no 0.946 0.479 0.326 5e-14
>sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 Back     alignment and function desciption
 Score =  231 bits (588), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/150 (72%), Positives = 130/150 (86%), Gaps = 1/150 (0%)

Query: 1   MASNNQ-PPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHC 59
           MAS  Q PPQKQ++QPGKEH+M+P PQ  SP Y P+NKL+G VALVTGGDSGIGR+VC+ 
Sbjct: 1   MASGGQFPPQKQESQPGKEHLMDPSPQHASPHYKPANKLQGKVALVTGGDSGIGRSVCYH 60

Query: 60  FAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVV 119
           FA EGATVAFT+VK  EDKDA ETLE+LR+AK+ DAKDP+AI+ADLGFD+NCK+VVD+VV
Sbjct: 61  FALEGATVAFTFVKGHEDKDANETLELLRKAKSSDAKDPIAIAADLGFDDNCKKVVDQVV 120

Query: 120 NAYDRIDILVNNAAEQYECGSVEDIDESRL 149
           NA+  ID+LVNNAAEQY+  +VEDIDE RL
Sbjct: 121 NAFGSIDVLVNNAAEQYKASTVEDIDEERL 150




May act as a short alcohol-polyol-sugar dehydrogenase possibly related to carbohydrate metabolism and the acquisition of desiccation tolerance. May also be involved in signal transduction.
Daucus carota (taxid: 4039)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=1 SV=1 Back     alignment and function description
>sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 Back     alignment and function description
>sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 Back     alignment and function description
>sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 Back     alignment and function description
>sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 Back     alignment and function description
>sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 Back     alignment and function description
>sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 Back     alignment and function description
>sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 Back     alignment and function description
>sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
357441633 293 Glucose and ribitol dehydrogenase [Medic 1.0 0.508 0.801 2e-65
357441635191 Glucose and ribitol dehydrogenase [Medic 1.0 0.780 0.801 2e-65
357512025 293 Glucose and ribitol dehydrogenase-like p 0.959 0.488 0.797 1e-63
388502942 293 unknown [Lotus japonicus] 1.0 0.508 0.768 4e-63
388514647 293 unknown [Lotus japonicus] 1.0 0.508 0.761 1e-62
224123214 293 predicted protein [Populus trichocarpa] 1.0 0.508 0.781 1e-62
449435679 293 PREDICTED: glucose and ribitol dehydroge 1.0 0.508 0.761 3e-60
449518007 293 PREDICTED: glucose and ribitol dehydroge 1.0 0.508 0.754 1e-59
23194375 294 putative TAG factor protein [Lupinus ang 1.0 0.506 0.736 7e-59
351722943 293 seed maturation protein PM34 [Glycine ma 0.899 0.457 0.805 8e-59
>gi|357441633|ref|XP_003591094.1| Glucose and ribitol dehydrogenase [Medicago truncatula] gi|355480142|gb|AES61345.1| Glucose and ribitol dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 2/151 (1%)

Query: 1   MASNNQ--PPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCH 58
           MAS  Q  PPQKQDTQPGKEHVM+P+PQFT PDY PSNKL+G VA++TGGDSGIGRAVC+
Sbjct: 1   MASGEQKFPPQKQDTQPGKEHVMDPLPQFTCPDYKPSNKLQGKVAVITGGDSGIGRAVCN 60

Query: 59  CFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEV 118
            F+ EGATVAFTYVK  EDKDAK+TLEMLR AK+ DAKDPMA++ADLGFDENCK+VVDE+
Sbjct: 61  LFSLEGATVAFTYVKGDEDKDAKDTLEMLRNAKSADAKDPMAVAADLGFDENCKKVVDEI 120

Query: 119 VNAYDRIDILVNNAAEQYECGSVEDIDESRL 149
           VNAY  IDILVNNAAEQYEC SVE+IDESRL
Sbjct: 121 VNAYGHIDILVNNAAEQYECSSVEEIDESRL 151




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357441635|ref|XP_003591095.1| Glucose and ribitol dehydrogenase [Medicago truncatula] gi|355480143|gb|AES61346.1| Glucose and ribitol dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357512025|ref|XP_003626301.1| Glucose and ribitol dehydrogenase-like protein [Medicago truncatula] gi|87240540|gb|ABD32398.1| Short-chain dehydrogenase/reductase SDR [Medicago truncatula] gi|355501316|gb|AES82519.1| Glucose and ribitol dehydrogenase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388502942|gb|AFK39537.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388514647|gb|AFK45385.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224123214|ref|XP_002319022.1| predicted protein [Populus trichocarpa] gi|222857398|gb|EEE94945.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449435679|ref|XP_004135622.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449518007|ref|XP_004166035.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|23194375|gb|AAN15136.1| putative TAG factor protein [Lupinus angustifolius] gi|26000394|gb|AAN75426.1| putative TAG-associated factor [Lupinus angustifolius] Back     alignment and taxonomy information
>gi|351722943|ref|NP_001238285.1| seed maturation protein PM34 [Glycine max] gi|9622153|gb|AAF89645.1|AF169018_1 seed maturation protein PM34 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
TAIR|locus:2096284 289 AT3G05260 [Arabidopsis thalian 0.986 0.508 0.697 2.7e-52
TIGR_CMR|BA_0748 288 BA_0748 "oxidoreductase, short 0.919 0.475 0.426 7.6e-25
ASPGD|ASPL0000046791 296 AN9002 [Emericella nidulans (t 0.939 0.472 0.403 3e-21
ASPGD|ASPL0000013842 302 AN3679 [Emericella nidulans (t 0.939 0.463 0.406 1.7e-20
UNIPROTKB|P0AG84 294 yghA "predicted glutathionylsp 0.885 0.448 0.347 4.7e-16
DICTYBASE|DDB_G0272154 301 DDB_G0272154 "short-chain dehy 0.919 0.455 0.380 4e-15
POMBASE|SPAC4H3.08 286 SPAC4H3.08 "3-hydroxyacyl-CoA 0.919 0.479 0.321 4e-13
TIGR_CMR|BA_1330 247 BA_1330 "3-oxoacyl-[acyl-carri 0.604 0.364 0.416 5.6e-13
WB|WBGene00009153 279 F26D2.15 [Caenorhabditis elega 0.617 0.329 0.395 2e-11
WB|WBGene00044811 280 F12E12.11 [Caenorhabditis eleg 0.617 0.328 0.385 5.7e-11
TAIR|locus:2096284 AT3G05260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 542 (195.9 bits), Expect = 2.7e-52, P = 2.7e-52
 Identities = 104/149 (69%), Positives = 127/149 (85%)

Query:     1 MASNNQPPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCF 60
             MAS   PPQKQ+TQPG +HVM P P+F+S +Y PSNKL G VALVTGGDSGIG+AVCHC+
Sbjct:     1 MASGF-PPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCY 59

Query:    61 AQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVN 120
             A EGA+VAFTYVK +EDKDA+ETL +L E KT +AK+P+ I+ DLGF+ENCKRVV+EVVN
Sbjct:    60 ALEGASVAFTYVKGREDKDAEETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVN 119

Query:   121 AYDRIDILVNNAAEQYECGSVEDIDESRL 149
             ++ RID+LVN AAEQ+E  S+EDIDE+RL
Sbjct:   120 SFGRIDVLVNCAAEQHEV-SIEDIDEARL 147




GO:0000166 "nucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
TIGR_CMR|BA_0748 BA_0748 "oxidoreductase, short chain dehydrogenase/reductase family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046791 AN9002 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000013842 AN3679 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|P0AG84 yghA "predicted glutathionylspermidine synthase, with NAD(P)-binding Rossmann-fold domain" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272154 DDB_G0272154 "short-chain dehydrogenase/reductase (SDR) family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC4H3.08 SPAC4H3.08 "3-hydroxyacyl-CoA dehydrogenase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1330 BA_1330 "3-oxoacyl-[acyl-carrier protein] reductase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
WB|WBGene00009153 F26D2.15 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00044811 F12E12.11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FZ42GRDH1_ARATH1, ., 1, ., 1, ., -0.75170.94630.4895yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
cd05355 270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 1e-55
PRK06701 290 PRK06701, PRK06701, short chain dehydrogenase; Pro 1e-44
COG1028 251 COG1028, FabG, Dehydrogenases with different speci 2e-25
PRK05557 248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-23
PRK06128 300 PRK06128, PRK06128, oxidoreductase; Provisional 2e-23
PRK05565 247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-22
cd05233 234 cd05233, SDR_c, classical (c) SDRs 3e-21
cd05333 240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 1e-20
PRK07985 294 PRK07985, PRK07985, oxidoreductase; Provisional 2e-18
PRK12825 249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-18
PRK05653 246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 5e-18
PRK12826 251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 6e-18
PRK06077 252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-18
PRK12935 247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 2e-17
TIGR01830 239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 2e-17
cd05359 242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 3e-17
PRK07231 251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-17
cd05358 253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 7e-17
cd05369 249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 7e-17
PRK07067 257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 1e-16
PRK06138 252 PRK06138, PRK06138, short chain dehydrogenase; Pro 3e-16
cd05344 253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 4e-16
PRK08213 259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 5e-16
PRK12429 258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 5e-16
PRK06463 255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-15
cd05364 253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 3e-15
PRK06172 253 PRK06172, PRK06172, short chain dehydrogenase; Pro 3e-15
PRK06181 263 PRK06181, PRK06181, short chain dehydrogenase; Pro 9e-15
PRK12939 250 PRK12939, PRK12939, short chain dehydrogenase; Pro 9e-15
cd05332 257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 1e-14
PRK06841 255 PRK06841, PRK06841, short chain dehydrogenase; Pro 3e-14
PRK06200 263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 5e-14
PRK08324 681 PRK08324, PRK08324, short chain dehydrogenase; Val 6e-14
cd05338 246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 7e-14
PRK08628 258 PRK08628, PRK08628, short chain dehydrogenase; Pro 1e-13
PRK12937 245 PRK12937, PRK12937, short chain dehydrogenase; Pro 2e-13
PRK07201 657 PRK07201, PRK07201, short chain dehydrogenase; Pro 2e-13
TIGR01963 255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 2e-13
cd05362 243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 2e-13
PRK07063 260 PRK07063, PRK07063, short chain dehydrogenase; Pro 2e-13
PRK12829 264 PRK12829, PRK12829, short chain dehydrogenase; Pro 3e-13
cd05341 247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 3e-13
PRK07478 254 PRK07478, PRK07478, short chain dehydrogenase; Pro 3e-13
cd05374 248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 5e-13
PRK08063 250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 5e-13
PRK06523 260 PRK06523, PRK06523, short chain dehydrogenase; Pro 5e-13
PRK12823 260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 5e-13
PRK06398 258 PRK06398, PRK06398, aldose dehydrogenase; Validate 5e-13
TIGR01829 242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 7e-13
cd05352 252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 8e-13
PRK08936 261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 8e-13
cd05345 248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 8e-13
PRK06198 260 PRK06198, PRK06198, short chain dehydrogenase; Pro 1e-12
PRK12743 256 PRK12743, PRK12743, oxidoreductase; Provisional 1e-12
PRK07677 252 PRK07677, PRK07677, short chain dehydrogenase; Pro 2e-12
PRK09242 257 PRK09242, PRK09242, tropinone reductase; Provision 7e-12
PLN02253 280 PLN02253, PLN02253, xanthoxin dehydrogenase 9e-12
cd05347 248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 1e-11
PRK06935 258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 1e-11
TIGR01832 248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 2e-11
cd08932 223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 2e-11
cd05363 254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 2e-11
PRK06125 259 PRK06125, PRK06125, short chain dehydrogenase; Pro 2e-11
PRK06500 249 PRK06500, PRK06500, short chain dehydrogenase; Pro 2e-11
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 3e-11
PRK07890 258 PRK07890, PRK07890, short chain dehydrogenase; Pro 3e-11
cd08943 250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 3e-11
PRK09135 249 PRK09135, PRK09135, pteridine reductase; Provision 4e-11
COG4221 246 COG4221, COG4221, Short-chain alcohol dehydrogenas 4e-11
cd08933 261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 4e-11
cd08937 256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 4e-11
PRK07856 252 PRK07856, PRK07856, short chain dehydrogenase; Pro 4e-11
cd05348 257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 4e-11
cd08942 250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 5e-11
PRK06113 255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 5e-11
PRK12748 256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 6e-11
PRK06182 273 PRK06182, PRK06182, short chain dehydrogenase; Val 7e-11
PRK07326 237 PRK07326, PRK07326, short chain dehydrogenase; Pro 7e-11
PRK12746 254 PRK12746, PRK12746, short chain dehydrogenase; Pro 9e-11
cd05330 257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 1e-10
PRK05872 296 PRK05872, PRK05872, short chain dehydrogenase; Pro 1e-10
cd05327 269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 1e-10
PRK08265 261 PRK08265, PRK08265, short chain dehydrogenase; Pro 1e-10
PRK12827 249 PRK12827, PRK12827, short chain dehydrogenase; Pro 1e-10
PRK08226 263 PRK08226, PRK08226, short chain dehydrogenase; Pro 2e-10
PRK06179 270 PRK06179, PRK06179, short chain dehydrogenase; Pro 2e-10
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 2e-10
PRK07062 265 PRK07062, PRK07062, short chain dehydrogenase; Pro 2e-10
PRK07109 334 PRK07109, PRK07109, short chain dehydrogenase; Pro 3e-10
PRK12745 256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 3e-10
PRK06720169 PRK06720, PRK06720, hypothetical protein; Provisio 3e-10
TIGR03325 262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 3e-10
PRK07035 252 PRK07035, PRK07035, short chain dehydrogenase; Pro 4e-10
cd08940 258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 4e-10
PRK05866 293 PRK05866, PRK05866, short chain dehydrogenase; Pro 5e-10
PRK08589 272 PRK08589, PRK08589, short chain dehydrogenase; Val 5e-10
cd05357 234 cd05357, PR_SDR_c, pteridine reductase (PR), class 5e-10
cd08945 258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 5e-10
cd08934 243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 6e-10
cd05329 251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 7e-10
COG0300 265 COG0300, DltE, Short-chain dehydrogenases of vario 8e-10
cd05326 249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 8e-10
PRK05855 582 PRK05855, PRK05855, short chain dehydrogenase; Val 8e-10
cd05339 243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 1e-09
cd05370 228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 1e-09
cd05349 246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 1e-09
cd09761 242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 1e-09
cd08939 239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 1e-09
TIGR04316 250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 2e-09
PRK07774 250 PRK07774, PRK07774, short chain dehydrogenase; Pro 2e-09
cd05323 244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 2e-09
PRK06123 248 PRK06123, PRK06123, short chain dehydrogenase; Pro 3e-09
cd08929 226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 3e-09
PRK12859 256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote 5e-09
cd05365 242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 5e-09
PRK08416 260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydro 5e-09
PRK06057 255 PRK06057, PRK06057, short chain dehydrogenase; Pro 6e-09
PRK12384 259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 1e-08
cd08930 250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 1e-08
cd05324 225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 1e-08
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 2e-08
cd05337 255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 2e-08
PRK06914 280 PRK06914, PRK06914, short chain dehydrogenase; Pro 2e-08
cd05353 250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 2e-08
PRK08993 253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 2e-08
cd05350 239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 2e-08
PRK07814 263 PRK07814, PRK07814, short chain dehydrogenase; Pro 2e-08
PRK12828 239 PRK12828, PRK12828, short chain dehydrogenase; Pro 3e-08
PRK07825 273 PRK07825, PRK07825, short chain dehydrogenase; Pro 3e-08
PRK07806 248 PRK07806, PRK07806, short chain dehydrogenase; Pro 3e-08
PRK06171 266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 3e-08
TIGR03206 250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 4e-08
cd05346 249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 4e-08
PRK07831 262 PRK07831, PRK07831, short chain dehydrogenase; Pro 4e-08
cd08944 246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 5e-08
cd05366 257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 5e-08
TIGR02632 676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 6e-08
PRK08277 278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 6e-08
PRK06196 315 PRK06196, PRK06196, oxidoreductase; Provisional 6e-08
PRK09730 247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 6e-08
PRK06197 306 PRK06197, PRK06197, short chain dehydrogenase; Pro 7e-08
PRK08220 252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 7e-08
pfam13561 239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 8e-08
PRK07576 264 PRK07576, PRK07576, short chain dehydrogenase; Pro 9e-08
PRK06947 248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 1e-07
COG3967 245 COG3967, DltE, Short-chain dehydrogenase involved 1e-07
cd05360 233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 2e-07
PRK12742 237 PRK12742, PRK12742, oxidoreductase; Provisional 2e-07
PRK09134 258 PRK09134, PRK09134, short chain dehydrogenase; Pro 2e-07
PRK07666 239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-07
PRK07523 255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 2e-07
PRK07097 265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 2e-07
PRK12824 245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 3e-07
cd05372 250 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) 3e-07
PRK09072 263 PRK09072, PRK09072, short chain dehydrogenase; Pro 3e-07
PRK06124 256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 4e-07
cd08936 256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 4e-07
PRK12747 252 PRK12747, PRK12747, short chain dehydrogenase; Pro 4e-07
cd08935 271 cd08935, mannonate_red_SDR_c, putative D-mannonate 4e-07
cd05368 241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 4e-07
PRK07454 241 PRK07454, PRK07454, short chain dehydrogenase; Pro 4e-07
cd05371 252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 4e-07
PRK08643 256 PRK08643, PRK08643, acetoin reductase; Validated 5e-07
PRK12481 251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 5e-07
cd09763 265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 5e-07
PRK07832 272 PRK07832, PRK07832, short chain dehydrogenase; Pro 5e-07
PRK06114 254 PRK06114, PRK06114, short chain dehydrogenase; Pro 5e-07
PRK08261 450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 5e-07
PRK05693 274 PRK05693, PRK05693, short chain dehydrogenase; Pro 6e-07
PRK12744 257 PRK12744, PRK12744, short chain dehydrogenase; Pro 6e-07
PRK06180 277 PRK06180, PRK06180, short chain dehydrogenase; Pro 6e-07
PRK07792 306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-07
PRK08278 273 PRK08278, PRK08278, short chain dehydrogenase; Pro 8e-07
PRK08217 253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-06
COG0623 259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 1e-06
PRK13394 262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 1e-06
cd05322 257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 2e-06
cd05351 244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 2e-06
PRK07791 286 PRK07791, PRK07791, short chain dehydrogenase; Pro 3e-06
TIGR02415 254 TIGR02415, 23BDH, acetoin reductases 3e-06
PRK07060 245 PRK07060, PRK07060, short chain dehydrogenase; Pro 3e-06
TIGR03971 265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 4e-06
cd05340 236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 4e-06
PRK08303 305 PRK08303, PRK08303, short chain dehydrogenase; Pro 5e-06
TIGR02685 267 TIGR02685, pter_reduc_Leis, pteridine reductase 1e-05
cd05331 244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 1e-05
cd05367 241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 1e-05
PRK05854 313 PRK05854, PRK05854, short chain dehydrogenase; Pro 1e-05
PRK05650 270 PRK05650, PRK05650, short chain dehydrogenase; Pro 2e-05
PRK07069 251 PRK07069, PRK07069, short chain dehydrogenase; Val 2e-05
PRK06139 330 PRK06139, PRK06139, short chain dehydrogenase; Pro 2e-05
PRK05867 253 PRK05867, PRK05867, short chain dehydrogenase; Pro 3e-05
PRK08945 247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 5e-05
PRK06482 276 PRK06482, PRK06482, short chain dehydrogenase; Pro 8e-05
PRK08642 253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-05
PRK07074 257 PRK07074, PRK07074, short chain dehydrogenase; Pro 1e-04
cd05356 239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 1e-04
PRK09186 256 PRK09186, PRK09186, flagellin modification protein 1e-04
cd05343 250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 1e-04
PLN02780 320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 1e-04
PRK06194 287 PRK06194, PRK06194, hypothetical protein; Provisio 1e-04
PRK06949 258 PRK06949, PRK06949, short chain dehydrogenase; Pro 2e-04
PRK08267 260 PRK08267, PRK08267, short chain dehydrogenase; Pro 2e-04
cd05334 221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 4e-04
PRK05786 238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-04
PRK08340 259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provi 5e-04
PRK05875 276 PRK05875, PRK05875, short chain dehydrogenase; Pro 5e-04
PRK12938 246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 6e-04
cd09762 243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 7e-04
cd05354 235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 7e-04
PRK10538 248 PRK10538, PRK10538, malonic semialdehyde reductase 9e-04
smart00822180 smart00822, PKS_KR, This enzymatic domain is part 0.001
PRK05717 255 PRK05717, PRK05717, oxidoreductase; Validated 0.001
PRK08703 239 PRK08703, PRK08703, short chain dehydrogenase; Pro 0.001
cd09809 284 cd09809, human_WWOX_like_SDR_c-like, human WWOX (W 0.001
cd08953 436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 0.001
cd09807 274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 0.002
cd05325 233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 0.002
PRK05993 277 PRK05993, PRK05993, short chain dehydrogenase; Pro 0.002
PRK05876 275 PRK05876, PRK05876, short chain dehydrogenase; Pro 0.003
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
 Score =  175 bits (445), Expect = 1e-55
 Identities = 63/135 (46%), Positives = 84/135 (62%), Gaps = 5/135 (3%)

Query: 15  PGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKP 74
           PG E  M+P+P F    Y  S KL+G  AL+TGGDSGIGRAV   FA+EGA VA  Y+  
Sbjct: 1   PGIEAKMDPLPDFGEKSYKGSGKLKGKKALITGGDSGIGRAVAIAFAREGADVAINYLPE 60

Query: 75  QEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAE 134
           +ED DA+ET +++ E         + I  DLG +  C+ +V EVV  + ++DILVNNAA 
Sbjct: 61  EED-DAEETKKLIEEEGR----KCLLIPGDLGDESFCRDLVKEVVKEFGKLDILVNNAAY 115

Query: 135 QYECGSVEDIDESRL 149
           Q+   S+EDI   +L
Sbjct: 116 QHPQESIEDITTEQL 130


These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 270

>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180669 PRK06720, PRK06720, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236389 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187630 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|223696 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236229 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235627 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235608 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187669 cd09809, human_WWOX_like_SDR_c-like, human WWOX (WW domain-containing oxidoreductase)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
COG0300 265 DltE Short-chain dehydrogenases of various substra 99.85
KOG1205 282 consensus Predicted dehydrogenase [Secondary metab 99.85
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 99.84
PRK06128 300 oxidoreductase; Provisional 99.82
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.8
KOG0725 270 consensus Reductases with broad range of substrate 99.8
PRK06701 290 short chain dehydrogenase; Provisional 99.79
PRK05876 275 short chain dehydrogenase; Provisional 99.78
PRK05867 253 short chain dehydrogenase; Provisional 99.78
PRK08862 227 short chain dehydrogenase; Provisional 99.78
PRK07478 254 short chain dehydrogenase; Provisional 99.77
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 99.77
PRK07791 286 short chain dehydrogenase; Provisional 99.77
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.77
PRK08339 263 short chain dehydrogenase; Provisional 99.77
PRK06114 254 short chain dehydrogenase; Provisional 99.77
PRK06139 330 short chain dehydrogenase; Provisional 99.77
PRK05854 313 short chain dehydrogenase; Provisional 99.77
PRK07062 265 short chain dehydrogenase; Provisional 99.76
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 99.76
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 99.76
PRK07109 334 short chain dehydrogenase; Provisional 99.76
PRK08303 305 short chain dehydrogenase; Provisional 99.76
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
PRK08589 272 short chain dehydrogenase; Validated 99.76
PRK05872 296 short chain dehydrogenase; Provisional 99.75
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.75
PRK06720169 hypothetical protein; Provisional 99.75
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 99.75
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 99.75
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 99.75
KOG1208 314 consensus Dehydrogenases with different specificit 99.74
PRK08085 254 gluconate 5-dehydrogenase; Provisional 99.74
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 99.74
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.74
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 99.74
PRK07985 294 oxidoreductase; Provisional 99.73
PRK07063 260 short chain dehydrogenase; Provisional 99.73
PRK06194 287 hypothetical protein; Provisional 99.73
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 99.73
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.73
PRK07523 255 gluconate 5-dehydrogenase; Provisional 99.73
PRK07097 265 gluconate 5-dehydrogenase; Provisional 99.73
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.73
PRK06124 256 gluconate 5-dehydrogenase; Provisional 99.73
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 99.72
PRK07890 258 short chain dehydrogenase; Provisional 99.72
PRK06172 253 short chain dehydrogenase; Provisional 99.72
PRK08278 273 short chain dehydrogenase; Provisional 99.72
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.72
PLN02253 280 xanthoxin dehydrogenase 99.72
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.72
PRK07035 252 short chain dehydrogenase; Provisional 99.72
PRK07814 263 short chain dehydrogenase; Provisional 99.71
PRK05866 293 short chain dehydrogenase; Provisional 99.71
PRK08643 256 acetoin reductase; Validated 99.71
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 99.71
PRK05717 255 oxidoreductase; Validated 99.71
PRK09242 257 tropinone reductase; Provisional 99.7
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 99.7
PRK07677 252 short chain dehydrogenase; Provisional 99.7
PRK07453 322 protochlorophyllide oxidoreductase; Validated 99.7
KOG1200 256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.7
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.7
PRK08277 278 D-mannonate oxidoreductase; Provisional 99.7
PRK08936 261 glucose-1-dehydrogenase; Provisional 99.69
PRK12744 257 short chain dehydrogenase; Provisional 99.69
PRK12743 256 oxidoreductase; Provisional 99.69
PRK07576 264 short chain dehydrogenase; Provisional 99.69
PRK08265 261 short chain dehydrogenase; Provisional 99.69
PRK08226 263 short chain dehydrogenase; Provisional 99.69
PRK06398 258 aldose dehydrogenase; Validated 99.69
PRK08213 259 gluconate 5-dehydrogenase; Provisional 99.69
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.69
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.69
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 99.69
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.69
PRK12938 246 acetyacetyl-CoA reductase; Provisional 99.68
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.68
PRK09134 258 short chain dehydrogenase; Provisional 99.68
PRK06197 306 short chain dehydrogenase; Provisional 99.68
PRK05599 246 hypothetical protein; Provisional 99.68
PRK08340 259 glucose-1-dehydrogenase; Provisional 99.68
PRK06138 252 short chain dehydrogenase; Provisional 99.68
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.67
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.67
PRK08628 258 short chain dehydrogenase; Provisional 99.67
PRK05855 582 short chain dehydrogenase; Validated 99.67
PRK08251 248 short chain dehydrogenase; Provisional 99.67
PRK12937 245 short chain dehydrogenase; Provisional 99.67
PRK12939 250 short chain dehydrogenase; Provisional 99.67
PRK07825 273 short chain dehydrogenase; Provisional 99.67
PRK07856 252 short chain dehydrogenase; Provisional 99.67
PRK07831 262 short chain dehydrogenase; Provisional 99.67
PRK06949 258 short chain dehydrogenase; Provisional 99.67
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 99.67
PRK12935 247 acetoacetyl-CoA reductase; Provisional 99.67
PRK06484 520 short chain dehydrogenase; Validated 99.67
PRK07454 241 short chain dehydrogenase; Provisional 99.66
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 99.66
PRK07067 257 sorbitol dehydrogenase; Provisional 99.66
TIGR02415 254 23BDH acetoin reductases. One member of this famil 99.66
PRK07024 257 short chain dehydrogenase; Provisional 99.66
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 99.66
PRK09186 256 flagellin modification protein A; Provisional 99.66
PRK06123 248 short chain dehydrogenase; Provisional 99.66
PRK07774 250 short chain dehydrogenase; Provisional 99.66
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 99.66
PRK05650 270 short chain dehydrogenase; Provisional 99.66
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
PRK12747 252 short chain dehydrogenase; Provisional 99.65
PRK06500 249 short chain dehydrogenase; Provisional 99.65
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.65
PRK06182 273 short chain dehydrogenase; Validated 99.65
PRK06947 248 glucose-1-dehydrogenase; Provisional 99.65
PRK06523 260 short chain dehydrogenase; Provisional 99.65
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.65
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.65
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.65
PRK06841 255 short chain dehydrogenase; Provisional 99.64
PRK06196 315 oxidoreductase; Provisional 99.64
PRK09072 263 short chain dehydrogenase; Provisional 99.64
PLN00015 308 protochlorophyllide reductase 99.64
PRK05875 276 short chain dehydrogenase; Provisional 99.64
PRK06179 270 short chain dehydrogenase; Provisional 99.64
PRK12827 249 short chain dehydrogenase; Provisional 99.64
PRK06180 277 short chain dehydrogenase; Provisional 99.64
PRK08267 260 short chain dehydrogenase; Provisional 99.64
PRK06483 236 dihydromonapterin reductase; Provisional 99.64
PRK06198 260 short chain dehydrogenase; Provisional 99.64
PRK06914 280 short chain dehydrogenase; Provisional 99.63
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.63
PRK08263 275 short chain dehydrogenase; Provisional 99.63
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.63
PRK12746 254 short chain dehydrogenase; Provisional 99.62
PRK06484 520 short chain dehydrogenase; Validated 99.62
PRK07775 274 short chain dehydrogenase; Provisional 99.62
PRK07832 272 short chain dehydrogenase; Provisional 99.62
PRK06125 259 short chain dehydrogenase; Provisional 99.62
PRK12824 245 acetoacetyl-CoA reductase; Provisional 99.62
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.62
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 99.62
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.62
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 99.61
PRK06181 263 short chain dehydrogenase; Provisional 99.61
PRK09135 249 pteridine reductase; Provisional 99.61
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 99.61
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.61
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.61
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.61
PRK07806 248 short chain dehydrogenase; Provisional 99.61
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.61
PRK07326 237 short chain dehydrogenase; Provisional 99.61
PRK05993 277 short chain dehydrogenase; Provisional 99.61
PRK08703 239 short chain dehydrogenase; Provisional 99.6
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.6
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.6
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.6
TIGR01831 239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.6
PRK07074 257 short chain dehydrogenase; Provisional 99.6
PRK12828 239 short chain dehydrogenase; Provisional 99.6
PRK06057 255 short chain dehydrogenase; Provisional 99.6
PRK05693 274 short chain dehydrogenase; Provisional 99.59
PRK12829 264 short chain dehydrogenase; Provisional 99.59
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.59
COG1028 251 FabG Dehydrogenases with different specificities ( 99.59
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.59
PRK06482 276 short chain dehydrogenase; Provisional 99.58
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.58
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.58
PLN02780 320 ketoreductase/ oxidoreductase 99.58
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.58
PRK06940 275 short chain dehydrogenase; Provisional 99.58
PRK07201 657 short chain dehydrogenase; Provisional 99.58
PRK10538 248 malonic semialdehyde reductase; Provisional 99.58
COG0623 259 FabI Enoyl-[acyl-carrier-protein] 99.57
KOG1199 260 consensus Short-chain alcohol dehydrogenase/3-hydr 99.57
KOG4169 261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.57
PRK07904 253 short chain dehydrogenase; Provisional 99.57
PRK07069 251 short chain dehydrogenase; Validated 99.57
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 99.56
KOG1610 322 consensus Corticosteroid 11-beta-dehydrogenase and 99.56
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.54
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.54
PRK08324 681 short chain dehydrogenase; Validated 99.54
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 99.53
TIGR01830 239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.51
PRK07102 243 short chain dehydrogenase; Provisional 99.51
PRK12742 237 oxidoreductase; Provisional 99.49
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.48
PRK09291 257 short chain dehydrogenase; Provisional 99.48
PRK06924 251 short chain dehydrogenase; Provisional 99.48
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.48
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 99.47
PRK08177 225 short chain dehydrogenase; Provisional 99.47
PRK07023 243 short chain dehydrogenase; Provisional 99.46
KOG1207 245 consensus Diacetyl reductase/L-xylulose reductase 99.46
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.46
PRK07577 234 short chain dehydrogenase; Provisional 99.45
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.45
PRK07041 230 short chain dehydrogenase; Provisional 99.45
PRK08264 238 short chain dehydrogenase; Validated 99.44
KOG1478 341 consensus 3-keto sterol reductase [Lipid transport 99.44
PRK07060 245 short chain dehydrogenase; Provisional 99.43
PRK06101 240 short chain dehydrogenase; Provisional 99.42
KOG1611 249 consensus Predicted short chain-type dehydrogenase 99.41
PRK12367 245 short chain dehydrogenase; Provisional 99.41
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 99.4
PRK08017 256 oxidoreductase; Provisional 99.39
PRK06953 222 short chain dehydrogenase; Provisional 99.33
PRK09009 235 C factor cell-cell signaling protein; Provisional 99.32
PRK05884 223 short chain dehydrogenase; Provisional 99.32
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 99.32
PRK08219 227 short chain dehydrogenase; Provisional 99.3
PRK07578 199 short chain dehydrogenase; Provisional 99.3
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.26
PLN02653 340 GDP-mannose 4,6-dehydratase 99.22
PLN03209 576 translocon at the inner envelope of chloroplast su 99.22
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.22
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 99.2
PLN02572 442 UDP-sulfoquinovose synthase 99.2
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.18
PLN02240 352 UDP-glucose 4-epimerase 99.16
PRK08309177 short chain dehydrogenase; Provisional 99.16
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 99.13
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.12
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 99.12
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.08
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.08
PLN00198 338 anthocyanidin reductase; Provisional 99.07
TIGR02114 227 coaB_strep phosphopantothenate--cysteine ligase, s 99.05
PLN02214 342 cinnamoyl-CoA reductase 99.04
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 99.04
PRK10675 338 UDP-galactose-4-epimerase; Provisional 98.99
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 98.97
PLN02650 351 dihydroflavonol-4-reductase 98.96
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.92
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 98.92
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 98.91
PLN02583 297 cinnamoyl-CoA reductase 98.9
PLN02686 367 cinnamoyl-CoA reductase 98.88
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.87
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 98.86
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 98.82
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 98.82
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 98.8
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 98.8
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 98.78
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.78
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 98.78
PLN02427 386 UDP-apiose/xylose synthase 98.77
CHL00194 317 ycf39 Ycf39; Provisional 98.72
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 98.7
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.7
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 98.63
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.61
PLN02260 668 probable rhamnose biosynthetic enzyme 98.61
TIGR01746 367 Thioester-redct thioester reductase domain. It has 98.59
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 98.59
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 98.59
PLN02695 370 GDP-D-mannose-3',5'-epimerase 98.58
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.58
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.55
KOG1204 253 consensus Predicted dehydrogenase [Secondary metab 98.53
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.52
PRK05865 854 hypothetical protein; Provisional 98.51
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.51
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.51
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.5
PLN02996 491 fatty acyl-CoA reductase 98.45
PLN02166 436 dTDP-glucose 4,6-dehydratase 98.41
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.41
PLN02206 442 UDP-glucuronate decarboxylase 98.4
PLN02503 605 fatty acyl-CoA reductase 2 98.39
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.38
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.38
COG4982 866 3-oxoacyl-[acyl-carrier protein] 98.37
PF07993 249 NAD_binding_4: Male sterility protein; InterPro: I 98.37
PRK06732 229 phosphopantothenate--cysteine ligase; Validated 98.36
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.3
PRK07201 657 short chain dehydrogenase; Provisional 98.27
PLN02778 298 3,5-epimerase/4-reductase 98.25
PRK12320 699 hypothetical protein; Provisional 98.25
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.24
COG3320 382 Putative dehydrogenase domain of multifunctional n 98.22
PRK09620 229 hypothetical protein; Provisional 98.22
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.2
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 98.12
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.12
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.11
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.11
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.09
PLN00016 378 RNA-binding protein; Provisional 98.05
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.0
KOG2733 423 consensus Uncharacterized membrane protein [Functi 97.96
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 97.95
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.92
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 97.86
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 97.86
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 97.77
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 97.75
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 97.73
PLN02260 668 probable rhamnose biosynthetic enzyme 97.73
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 97.7
PRK14982340 acyl-ACP reductase; Provisional 97.62
KOG1429 350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 97.54
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.39
PRK06849 389 hypothetical protein; Provisional 97.34
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.29
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.27
COG2910 211 Putative NADH-flavin reductase [General function p 97.25
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.1
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 97.08
PF08643 299 DUF1776: Fungal family of unknown function (DUF177 97.07
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 97.02
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.94
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 96.9
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 96.9
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.86
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 96.79
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.79
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.78
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.78
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.75
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.75
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 96.73
KOG1372 376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 96.71
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 96.61
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 96.6
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.59
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.58
KOG4022 236 consensus Dihydropteridine reductase DHPR/QDPR [Am 96.57
PRK13940 414 glutamyl-tRNA reductase; Provisional 96.55
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 96.53
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.47
KOG1431 315 consensus GDP-L-fucose synthetase [Carbohydrate tr 96.44
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.44
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 96.43
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 96.4
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.4
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 96.35
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.29
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.27
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.25
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 96.2
COG3007 398 Uncharacterized paraquat-inducible protein B [Func 96.18
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 96.14
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.12
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.04
PRK04148134 hypothetical protein; Provisional 96.01
PRK09496 453 trkA potassium transporter peripheral membrane com 95.99
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.98
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.98
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 95.92
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.89
PLN00106 323 malate dehydrogenase 95.89
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.88
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 95.87
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.86
COG3268 382 Uncharacterized conserved protein [Function unknow 95.84
PRK12480330 D-lactate dehydrogenase; Provisional 95.8
PRK13243333 glyoxylate reductase; Reviewed 95.8
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 95.77
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 95.77
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 95.75
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.73
PLN00203 519 glutamyl-tRNA reductase 95.72
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 95.72
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.7
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.69
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 95.65
PTZ00325 321 malate dehydrogenase; Provisional 95.65
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.63
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.62
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.6
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.58
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 95.58
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.57
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.54
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.53
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 95.5
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 95.5
PRK06487317 glycerate dehydrogenase; Provisional 95.48
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.47
KOG0747 331 consensus Putative NAD+-dependent epimerases [Carb 95.46
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.46
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.43
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 95.42
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.41
KOG4039 238 consensus Serine/threonine kinase TIP30/CC3 [Signa 95.4
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 95.39
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.39
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.36
PLN02928347 oxidoreductase family protein 95.31
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.31
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.29
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 95.29
PRK05086 312 malate dehydrogenase; Provisional 95.25
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.24
PRK09496 453 trkA potassium transporter peripheral membrane com 95.23
PRK13403 335 ketol-acid reductoisomerase; Provisional 95.22
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 95.18
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 95.17
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.16
PLN02740381 Alcohol dehydrogenase-like 95.13
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 95.12
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 95.11
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 95.11
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.07
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.04
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 95.03
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.02
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 94.97
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 94.96
PRK06719157 precorrin-2 dehydrogenase; Validated 94.93
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 94.92
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 94.91
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 94.83
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 94.83
PRK07574385 formate dehydrogenase; Provisional 94.81
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 94.8
PLN03139386 formate dehydrogenase; Provisional 94.8
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 94.79
cd01489 312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 94.79
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 94.79
PRK06932314 glycerate dehydrogenase; Provisional 94.78
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 94.77
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 94.75
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.73
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 94.64
PTZ00354334 alcohol dehydrogenase; Provisional 94.63
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 94.61
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.6
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 94.56
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 94.46
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 94.45
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.4
PRK13771334 putative alcohol dehydrogenase; Provisional 94.39
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.32
PRK08655 437 prephenate dehydrogenase; Provisional 94.32
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 94.32
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 94.28
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 94.24
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.22
PRK13886 241 conjugal transfer protein TraL; Provisional 94.22
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 94.19
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 94.19
PLN02712 667 arogenate dehydrogenase 94.15
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 94.13
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 94.12
PLN02586360 probable cinnamyl alcohol dehydrogenase 94.11
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 94.1
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 94.09
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 94.07
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.05
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 94.05
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 94.01
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 93.98
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 93.96
PLN02178375 cinnamyl-alcohol dehydrogenase 93.92
PRK12767 326 carbamoyl phosphate synthase-like protein; Provisi 93.89
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 93.84
PRK06436303 glycerate dehydrogenase; Provisional 93.82
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.82
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 93.79
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 93.79
PLN02827378 Alcohol dehydrogenase-like 93.7
COG2085 211 Predicted dinucleotide-binding enzymes [General fu 93.68
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 93.67
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.66
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.62
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 93.61
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 93.6
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 93.59
KOG2774 366 consensus NAD dependent epimerase [General functio 93.59
COG2894 272 MinD Septum formation inhibitor-activating ATPase 93.57
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 93.57
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 93.56
PRK08328231 hypothetical protein; Provisional 93.55
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 93.55
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 93.53
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.51
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.49
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 93.48
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.47
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 93.45
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 93.43
PRK15116 268 sulfur acceptor protein CsdL; Provisional 93.42
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.36
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.36
PLN02494 477 adenosylhomocysteinase 93.35
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.35
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.32
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 93.32
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 93.3
PTZ00075 476 Adenosylhomocysteinase; Provisional 93.18
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 93.1
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.07
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 93.07
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
Probab=99.85  E-value=1.8e-20  Score=137.86  Aligned_cols=105  Identities=27%  Similarity=0.370  Sum_probs=91.2

Q ss_pred             CCCCCEEEEecCCChHHHHHHHHHHHcCCcEEEEecCCCChHHHHHHHHHHHhccCCCCCCceEEEecCCChHHHHHHHH
Q 044851           37 KLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVD  116 (149)
Q Consensus        37 ~~~~~~~litG~s~gig~~~a~~L~~~g~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~  116 (149)
                      .+.++++||||||+|||+++|+.|+++|++|+++.|+   .+.+.+..+++...   .+..+.++.+|+++++++..+..
T Consensus         3 ~~~~~~~lITGASsGIG~~~A~~lA~~g~~liLvaR~---~~kL~~la~~l~~~---~~v~v~vi~~DLs~~~~~~~l~~   76 (265)
T COG0300           3 PMKGKTALITGASSGIGAELAKQLARRGYNLILVARR---EDKLEALAKELEDK---TGVEVEVIPADLSDPEALERLED   76 (265)
T ss_pred             CCCCcEEEEECCCchHHHHHHHHHHHCCCEEEEEeCc---HHHHHHHHHHHHHh---hCceEEEEECcCCChhHHHHHHH
Confidence            3578899999999999999999999999999999997   55666666777642   35678899999999999999999


Q ss_pred             HHHHhcCCccEEEeCCcCCCCCCCCCCCCCCC
Q 044851          117 EVVNAYDRIDILVNNAAEQYECGSVEDIDESR  148 (149)
Q Consensus       117 ~~~~~~g~id~li~~ag~~~~~~~~~~~s~~~  148 (149)
                      ++.++.+.||+||||||+... +++.+.+.++
T Consensus        77 ~l~~~~~~IdvLVNNAG~g~~-g~f~~~~~~~  107 (265)
T COG0300          77 ELKERGGPIDVLVNNAGFGTF-GPFLELSLDE  107 (265)
T ss_pred             HHHhcCCcccEEEECCCcCCc-cchhhCChHH
Confidence            999998899999999999887 7888877653



>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>COG3007 Uncharacterized paraquat-inducible protein B [Function unknown] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3i3o_A 291 2.06 Angstrom Resolution Crystal Structure Of A Sho 2e-26
3ijr_A 291 2.05 Angstrom Resolution Crystal Structure Of A Sho 1e-25
3r3s_A 294 Structure Of The Ygha Oxidoreductase From Salmonell 2e-14
2uvd_A 246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 3e-10
3t4x_A 267 Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDU 9e-10
2y93_A 281 Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2 4e-09
3sj7_A 252 Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F 1e-08
3v2g_A 271 Crystal Structure Of A DehydrogenaseREDUCTASE FROM 1e-08
2pnf_A 248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 1e-08
2d1y_A 256 Crystal Structure Of Tt0321 From Thermus Thermophil 2e-08
3osu_A 246 Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro 2e-08
3grp_A 266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 6e-08
1doh_A 283 Structure Of Trihydroxynaphthalene Reductase In Com 6e-08
1ybv_A 283 Structure Of Trihydroxynaphthalene Reductase In Com 7e-08
4e3z_A 272 Crystal Structure Of A Oxidoreductase From Rhizobiu 3e-07
1spx_A 278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 4e-07
3ai1_A 263 The Crystal Structure Of L-Sorbose Reductase From G 4e-07
3ai3_A 263 The Crystal Structure Of L-Sorbose Reductase From G 4e-07
1bdb_A 277 Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From 5e-07
1k2w_A 256 Crystal Structure Of Sorbitol Dehydrogenase From R. 6e-07
1yxm_A 303 Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa 6e-07
3afm_A 258 Crystal Structure Of Aldose Reductase A1-R Responsi 6e-07
2ztm_A 260 T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase L 6e-07
1wmb_A 260 Crystal Structure Of Nad Dependent D-3-Hydroxybutyl 6e-07
2ztu_A 260 T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase C 6e-07
1xkq_A 280 Crystal Structure Of Short-Chain DehydrogenaseREDUC 7e-07
3itd_A 270 Crystal Structure Of An Inactive 17beta-Hydroxyster 1e-06
3is3_A 270 Crystal Structure Of 17beta-Hydroxysteroid Dehydrog 1e-06
1xhl_A 297 Crystal Structure Of Putative Tropinone Reductase-I 1e-06
4fc6_A 277 Studies On Dcr Shed New Light On Peroxisomal Beta-O 1e-06
3o4r_A 261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 2e-06
1hxh_A 253 Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID D 2e-06
2b4q_A 276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 2e-06
3uf0_A 273 Crystal Structure Of A Putative Nad(P) Dependent Gl 2e-06
1gco_A 261 Crystal Structure Of Glucose Dehydrogenase Complexe 2e-06
1g6k_A 261 Crystal Structure Of Glucose Dehydrogenase Mutant E 2e-06
1rwb_A 261 Cooperative Effect Of Two Surface Amino Acid Mutati 2e-06
1gee_A 261 Crystal Structure Of Glucose Dehydrogenase Mutant Q 2e-06
3a28_C 258 Crystal Structure Of L-2,3-Butanediol Dehydrogenase 2e-06
3ay7_A 269 Crystal Structure Of Bacillus Megaterium Glucose De 3e-06
3aus_A 269 Crystal Structure Of Bacillus Megaterium Glucose De 3e-06
4dqx_A 277 Crystal Structure Of A Short Chain Dehydrogenase Fr 3e-06
3ay6_A 269 Crystal Structure Of Bacillus Megaterium Glucose De 3e-06
3icc_A 255 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Car 4e-06
2ew8_A 249 Crystal Structure Of The (s)-specific 1-phenylethan 5e-06
2et6_A 604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 6e-06
1vl8_A 267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 6e-06
4e6p_A 259 Crystal Structure Of A Probable Sorbitol Dehydrogen 8e-06
1nff_A 260 Crystal Structure Of Rv2002 Gene Product From Mycob 8e-06
3i4f_A 264 Structure Of Putative 3-oxoacyl-reductase From Baci 9e-06
2gdz_A 267 Crystal Structure Of 15-Hydroxyprostaglandin Dehydr 9e-06
3oec_A 317 Crystal Structure Of Carveol Dehydrogenase From Myc 1e-05
1ae1_A 273 Tropinone Reductase-I Complex With Nadp Length = 27 1e-05
3rih_A 293 Crystal Structure Of A Putative Short Chain Dehydro 1e-05
1zbq_A 327 Crystal Structure Of Human 17-beta-hydroxysteroid D 2e-05
3tzk_A 251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-05
1zem_A 262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 2e-05
3ctm_A 279 Crystal Structure Of A Carbonyl Reductase From Cand 2e-05
2p91_A 285 Crystal Structure Of Enoyl-[acyl-Carrier-Protein] R 2e-05
3qiv_A 253 Crystal Structure Of A Putative Short-Chain Dehydro 2e-05
1zjy_A 251 Structure Of R-Specific Alcohol Dehydrogenase (Muta 2e-05
4fn4_A 254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 3e-05
2rhr_B 277 P94l Actinorhodin Ketordeuctase Mutant, With Nadph 3e-05
3csd_B 281 Actinorhodin Polyketide Ketoreductase Mutant P94l B 3e-05
1nfr_A 260 Rv2002 Gene Product From Mycobacterium Tuberculosis 3e-05
3e03_A 274 Crystal Structure Of A Putative Dehydrogenase From 3e-05
4dbz_A 281 Crystal Structure Of V151l Actinorhodin Polyketide 4e-05
3gk3_A 269 Crystal Structure Of Acetoacetyl-Coa Reductase From 4e-05
4dc1_A 281 Crystal Structure Of Y202f Actinorhodin Polyketide 4e-05
1w4z_A 281 Structure Of Actinorhodin Polyketide (Actiii) Reduc 4e-05
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 4e-05
3op4_A 248 Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carr 4e-05
4dc0_A 281 Crystal Structure Of F189w Actinorhodin Polyketide 4e-05
2rh4_A 277 Actinorhodin Ketoreductase, Actkr, With Nadph And I 4e-05
3tzh_A 251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 4e-05
3u09_A 251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 4e-05
3rsh_A 251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 4e-05
3tzc_A 251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 5e-05
1x7g_A 261 Actinorhodin Polyketide Ketoreductase, Act Kr, With 5e-05
3oic_A 258 Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl 5e-05
2hq1_A 247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 5e-05
1nxq_A 251 Crystal Structure Of R-Alcohol Dehydrogenase (Radh) 5e-05
3cxr_A 291 Crystal Structure Of Gluconate 5-Dehydrogase From S 5e-05
2pd6_A 264 Structure Of Human Hydroxysteroid Dehydrogenase Typ 6e-05
3nug_A 247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 6e-05
3ndr_A 247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 7e-05
3g1t_A 258 Crystal Structure Of Short Chain Dehydrogenase From 7e-05
1p33_A 289 Pteridine Reductase From Leishmania Tarentolae Comp 8e-05
3o26_A 311 The Structure Of Salutaridine Reductase From Papave 1e-04
1iy8_A 267 Crystal Structure Of Levodione Reductase Length = 2 1e-04
3ged_A 247 Fingerprint And Structural Analysis Of A Apo Scor E 1e-04
3n74_A 261 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-04
2zat_A 260 Crystal Structure Of A Mammalian Reductase Length = 1e-04
3e9q_A 273 Crystal Structure Of The Short Chain Dehydrogenase 1e-04
4iqg_C 271 Crystal Structure Of Bpro0239 Oxidoreductase From P 1e-04
3u0b_A 454 Crystal Structure Of An Oxidoreductase From Mycobac 1e-04
2yz7_A 260 X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F 1e-04
3iah_A 256 Crystal Structure Of Short Chain Dehydrogenase (yci 1e-04
2cf2_E 226 Architecture Of Mammalian Fatty Acid Synthase Lengt 1e-04
3m1a_A 281 The Crystal Structure Of A Short-Chain Dehydrogenas 2e-04
1i01_A 244 Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr 2e-04
1q7c_A 244 The Structure Of Betaketoacyl-[acp] Reductase Y151f 2e-04
4dml_A 269 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn 2e-04
3tox_A 280 Crystal Structure Of A Short Chain Dehydrogenase In 2e-04
3v8b_A 283 Crystal Structure Of A 3-Ketoacyl-Acp Reductase Fro 2e-04
3tsc_A 277 Crystal Structure Of Short Chain Dehydrogenase Map_ 3e-04
3sc4_A 285 Crystal Structure Of A Short Chain Dehydrogenase (A 3e-04
1ahi_A 255 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With 3e-04
3ioy_A 319 Structure Of Putative Short-Chain Dehydrogenase (Sa 4e-04
3lyl_A 247 Structure Of 3-Oxoacyl-Acylcarrier Protein Reductas 4e-04
3f5s_A 255 Crystal Structure Of Putatitve Short Chain Dehydrog 4e-04
3lf1_A 265 Apo Structure Of The Short Chain Oxidoreductase Q9h 4e-04
3bmc_B 288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 5e-04
3vtz_A 269 Structure Of Thermoplasma Volcanium Aldohexose Dehy 5e-04
3jq7_A 288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 5e-04
3jq7_B 288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 5e-04
2c7v_A 268 Structure Of Trypanosoma Brucei Pteridine Reductase 5e-04
2wd7_B 268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 5e-04
2wd7_A 268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 6e-04
3bmc_A 288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 6e-04
4afn_A 269 Crystal Structure Of 3-ketoacyl-(acyl-carrier-prote 6e-04
3rkr_A 262 Crystal Structure Of A Metagenomic Short-Chain Oxid 7e-04
4ibo_A 271 Crystal Structure Of A Putative Gluconate Dehydroge 8e-04
3gdf_A 267 Crystal Structure Of The Nadp-Dependent Mannitol De 8e-04
>pdb|3I3O|A Chain A, 2.06 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad-acetone Length = 291 Back     alignment and structure

Iteration: 1

Score = 114 bits (285), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 61/143 (42%), Positives = 86/143 (60%), Gaps = 6/143 (4%) Query: 7 PPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGAT 66 P Q Q+ QPG E +MNP+PQF P+Y S KL+G L+TGGDSGIGRAV FA+EGA Sbjct: 14 PAQHQNKQPGIESLMNPLPQFEDPNYKGSEKLKGKNVLITGGDSGIGRAVSIAFAKEGAN 73 Query: 67 VAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRID 126 +A Y+ E+ DA ET + + + + + + DL +++CK +V E V ++ Sbjct: 74 IAIAYLD--EEGDANETKQYVEK----EGVKCVLLPGDLSDEQHCKDIVQETVRQLGSLN 127 Query: 127 ILVNNAAEQYECGSVEDIDESRL 149 ILVNN A+QY +E I +L Sbjct: 128 ILVNNVAQQYPQQGLEYITAEQL 150
>pdb|3IJR|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad+ Length = 291 Back     alignment and structure
>pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|3T4X|A Chain A, Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDUCTASE FROM Bacillus Anthracis Str. Ames Ancestor Length = 267 Back     alignment and structure
>pdb|2Y93|A Chain A, Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2,3- Dehydrogenase (Bphb)from Pandoraea Pnomenusa Strain B-356. Length = 281 Back     alignment and structure
>pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 Back     alignment and structure
>pdb|3V2G|A Chain A, Crystal Structure Of A DehydrogenaseREDUCTASE FROM SINORHIZOBIUM Meliloti 1021 Length = 271 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 Back     alignment and structure
>pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|1DOH|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And 4-nitro-inden-1-one Length = 283 Back     alignment and structure
>pdb|1YBV|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And An Active Site Inhibitor Length = 283 Back     alignment and structure
>pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 Back     alignment and structure
>pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 Back     alignment and structure
>pdb|1BDB|A Chain A, Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From Pseudomonas Sp. Lb400 Length = 277 Back     alignment and structure
>pdb|1K2W|A Chain A, Crystal Structure Of Sorbitol Dehydrogenase From R. Sphaeroides Length = 256 Back     alignment and structure
>pdb|1YXM|A Chain A, Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa Reductase Length = 303 Back     alignment and structure
>pdb|3AFM|A Chain A, Crystal Structure Of Aldose Reductase A1-R Responsible For Alginate Metabolism Length = 258 Back     alignment and structure
>pdb|2ZTM|A Chain A, T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|1WMB|A Chain A, Crystal Structure Of Nad Dependent D-3-Hydroxybutylate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|2ZTU|A Chain A, T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase Complexed With Nad+ Length = 260 Back     alignment and structure
>pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 Back     alignment and structure
>pdb|3ITD|A Chain A, Crystal Structure Of An Inactive 17beta-Hydroxysteroid Dehydrogenase (Y167f Mutated Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|3IS3|A Chain A, Crystal Structure Of 17beta-Hydroxysteroid Dehydrogenase (Apo Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|1HXH|A Chain A, Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID Dehydrogenase Length = 253 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 Back     alignment and structure
>pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 Back     alignment and structure
>pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|3A28|C Chain C, Crystal Structure Of L-2,3-Butanediol Dehydrogenase Length = 258 Back     alignment and structure
>pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 Back     alignment and structure
>pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 Back     alignment and structure
>pdb|3ICC|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis At 1.87 A Resolution Length = 255 Back     alignment and structure
>pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|4E6P|A Chain A, Crystal Structure Of A Probable Sorbitol Dehydrogenase (Target Psi- 012078) From Sinorhizobium Meliloti 1021 Length = 259 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3I4F|A Chain A, Structure Of Putative 3-oxoacyl-reductase From Bacillus Thuringiensis Length = 264 Back     alignment and structure
>pdb|2GDZ|A Chain A, Crystal Structure Of 15-Hydroxyprostaglandin Dehydrogenase Type1, Complexed With Nad+ Length = 267 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 Back     alignment and structure
>pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 Back     alignment and structure
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure
>pdb|3CTM|A Chain A, Crystal Structure Of A Carbonyl Reductase From Candida Parapsilosis With Anti-Prelog Stereo-Specificity Length = 279 Back     alignment and structure
>pdb|2P91|A Chain A, Crystal Structure Of Enoyl-[acyl-Carrier-Protein] Reductase (Nadh) From Aquifex Aeolicus Vf5 Length = 285 Back     alignment and structure
>pdb|3QIV|A Chain A, Crystal Structure Of A Putative Short-Chain Dehydrogenase Or 3- Oxoacyl-[acyl-Carrier-Protein] Reductase From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3E03|A Chain A, Crystal Structure Of A Putative Dehydrogenase From Xanthomonas Campestris Length = 274 Back     alignment and structure
>pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|3GK3|A Chain A, Crystal Structure Of Acetoacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 269 Back     alignment and structure
>pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|3OP4|A Chain A, Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Nadp+ Length = 248 Back     alignment and structure
>pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 Back     alignment and structure
>pdb|3OIC|A Chain A, Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl) From B. Subtilis (Apo Form) Length = 258 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|1NXQ|A Chain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|2PD6|A Chain A, Structure Of Human Hydroxysteroid Dehydrogenase Type 8, Hsd17b8 Length = 264 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3G1T|A Chain A, Crystal Structure Of Short Chain Dehydrogenase From Salmonella Enterica Subsp. Enterica Serovar Typhi Str. Ct18 Length = 258 Back     alignment and structure
>pdb|1P33|A Chain A, Pteridine Reductase From Leishmania Tarentolae Complex With Nadph And Mtx Length = 289 Back     alignment and structure
>pdb|3O26|A Chain A, The Structure Of Salutaridine Reductase From Papaver Somniferum Length = 311 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|3N74|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reduc Brucella Melitensis Length = 261 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|3E9Q|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase From Shigella Flexneri Length = 273 Back     alignment and structure
>pdb|4IQG|C Chain C, Crystal Structure Of Bpro0239 Oxidoreductase From Polaromonas Sp. Js666 In Nadp Bound Form Length = 271 Back     alignment and structure
>pdb|3U0B|A Chain A, Crystal Structure Of An Oxidoreductase From Mycobacterium Smegmatis Length = 454 Back     alignment and structure
>pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 Back     alignment and structure
>pdb|3IAH|A Chain A, Crystal Structure Of Short Chain Dehydrogenase (ycik) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 In Complex With Nadp And Acetate. Length = 256 Back     alignment and structure
>pdb|2CF2|E Chain E, Architecture Of Mammalian Fatty Acid Synthase Length = 226 Back     alignment and structure
>pdb|3M1A|A Chain A, The Crystal Structure Of A Short-Chain Dehydrogenase From Streptomyces Avermitilis To 2a Length = 281 Back     alignment and structure
>pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Back     alignment and structure
>pdb|1Q7C|A Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Back     alignment and structure
>pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 Back     alignment and structure
>pdb|3TOX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase In Complex With Nad(P) From Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|3V8B|A Chain A, Crystal Structure Of A 3-Ketoacyl-Acp Reductase From Sinorhizobium Meliloti 1021 Length = 283 Back     alignment and structure
>pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 Back     alignment and structure
>pdb|3SC4|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase (A0qtm2 Homolog) Mycobacterium Thermoresistibile Length = 285 Back     alignment and structure
>pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 Back     alignment and structure
>pdb|3IOY|A Chain A, Structure Of Putative Short-Chain Dehydrogenase (Saro_0793) From Novosphingobium Aromaticivorans Length = 319 Back     alignment and structure
>pdb|3LYL|A Chain A, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg From Francisella Tularensis Length = 247 Back     alignment and structure
>pdb|3F5S|A Chain A, Crystal Structure Of Putatitve Short Chain Dehydrogenase From Shigella Flexneri 2a Str. 301 Length = 255 Back     alignment and structure
>pdb|3LF1|A Chain A, Apo Structure Of The Short Chain Oxidoreductase Q9hya2 From Pseudomonas Aeruginosa Pao1 Containing An Atypical Catalytic Center Length = 265 Back     alignment and structure
>pdb|3BMC|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 Back     alignment and structure
>pdb|3JQ7|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|3JQ7|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|2C7V|A Chain A, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1) In Ternary Complex With Cofactor And The Antifolate Methotrexate Length = 268 Back     alignment and structure
>pdb|2WD7|B Chain B, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|2WD7|A Chain A, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|3BMC|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|4AFN|A Chain A, Crystal Structure Of 3-ketoacyl-(acyl-carrier-protein) Reductase (fabg) From Pseudomonas Aeruginosa At 2.3a Resolution Length = 269 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 Back     alignment and structure
>pdb|3GDF|A Chain A, Crystal Structure Of The Nadp-Dependent Mannitol Dehydrogenase From Cladosporium Herbarum. Length = 267 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 7e-63
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 1e-61
1xhl_A 297 Short-chain dehydrogenase/reductase family member 4e-38
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 6e-31
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 5e-30
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 2e-29
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 5e-29
1xkq_A 280 Short-chain reductase family member (5D234); parra 2e-28
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 4e-28
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 8e-28
1spx_A 278 Short-chain reductase family member (5L265); paral 2e-27
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 4e-27
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 7e-27
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 6e-26
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 8e-26
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 8e-26
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 1e-25
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 1e-25
3imf_A 257 Short chain dehydrogenase; structural genomics, in 1e-25
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 1e-25
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 1e-25
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 2e-25
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-25
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-25
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 3e-25
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 3e-25
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 3e-25
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 3e-25
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 4e-25
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 4e-25
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 4e-25
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 6e-25
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 6e-25
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 6e-25
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 7e-25
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 7e-25
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 7e-25
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 1e-24
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-24
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 2e-24
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 2e-24
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 2e-24
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 2e-24
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 3e-24
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 3e-24
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 3e-24
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 3e-24
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 3e-24
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 3e-24
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 4e-24
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 4e-24
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 4e-24
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 4e-24
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 4e-24
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 5e-24
3rih_A 293 Short chain dehydrogenase or reductase; structural 5e-24
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 6e-24
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 6e-24
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 7e-24
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 7e-24
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 8e-24
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 1e-23
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 1e-23
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 1e-23
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 1e-23
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 2e-23
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 2e-23
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 2e-23
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 2e-23
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 2e-23
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 2e-23
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 3e-23
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 3e-23
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 3e-23
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 3e-23
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 3e-23
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 4e-23
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 4e-23
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 4e-23
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 4e-23
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 5e-23
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 5e-23
1xq1_A 266 Putative tropinone reducatse; structural genomics, 5e-23
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 5e-23
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 6e-23
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 6e-23
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 6e-23
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 1e-22
4dqx_A 277 Probable oxidoreductase protein; structural genomi 1e-22
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 2e-22
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 2e-22
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 2e-22
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 2e-22
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 3e-22
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 4e-22
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 4e-22
3cxt_A 291 Dehydrogenase with different specificities; rossma 5e-22
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 6e-22
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 6e-22
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 6e-22
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 7e-22
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 8e-22
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 1e-21
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 1e-21
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 1e-21
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 2e-21
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 2e-21
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 2e-21
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 2e-21
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 2e-21
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 3e-21
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 4e-21
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 5e-21
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 5e-21
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 6e-21
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 6e-21
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 6e-21
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 6e-21
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 7e-21
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 8e-21
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 8e-21
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 1e-20
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 1e-20
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 1e-20
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 1e-20
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 1e-20
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 2e-20
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 2e-20
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 2e-20
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 3e-20
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 4e-20
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 5e-20
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 7e-20
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 1e-19
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 1e-19
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 1e-19
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 3e-19
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 3e-19
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 3e-19
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 4e-19
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 4e-19
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 5e-19
4e4y_A 244 Short chain dehydrogenase family protein; structur 5e-19
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 6e-19
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 3e-18
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 6e-18
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 7e-18
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 1e-17
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 7e-17
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 3e-16
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 5e-16
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 2e-15
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 2e-15
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 3e-15
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 5e-15
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 7e-15
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 8e-15
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 8e-15
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 2e-14
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 2e-14
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 3e-14
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 5e-14
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 5e-14
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 5e-14
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 2e-13
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 2e-13
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-13
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 3e-13
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 3e-13
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 3e-13
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 7e-13
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 2e-12
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 4e-12
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 5e-12
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 6e-12
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 1e-11
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-11
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 5e-11
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 2e-11
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 4e-11
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 6e-11
2yut_A 207 Putative short-chain oxidoreductase; alpha and bet 6e-10
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 7e-10
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 4e-09
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 5e-09
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 1e-07
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 1e-07
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 5e-07
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 8e-07
4alk_A 282 ENR, enoyl-[acyl-carrier-protein] reductase [NADPH 2e-06
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 1e-05
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 1e-05
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 3e-05
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 4e-05
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 5e-05
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 7e-05
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 7e-05
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 7e-05
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 7e-05
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 8e-05
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 8e-05
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 2e-04
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 3e-04
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 4e-04
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 7e-04
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
 Score =  193 bits (493), Expect = 7e-63
 Identities = 61/143 (42%), Positives = 85/143 (59%), Gaps = 6/143 (4%)

Query: 7   PPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCHCFAQEGAT 66
           P Q Q+ QPG E +MNP+PQF  P+Y  S KL+G   L+TGGDSGIGRAV   FA+EGA 
Sbjct: 14  PAQHQNKQPGIESLMNPLPQFEDPNYKGSEKLKGKNVLITGGDSGIGRAVSIAFAKEGAN 73

Query: 67  VAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVDEVVNAYDRID 126
           +A  Y+   E+ DA ET + + +         + +  DL  +++CK +V E V     ++
Sbjct: 74  IAIAYLD--EEGDANETKQYVEKEG----VKCVLLPGDLSDEQHCKDIVQETVRQLGSLN 127

Query: 127 ILVNNAAEQYECGSVEDIDESRL 149
           ILVNN A+QY    +E I   +L
Sbjct: 128 ILVNNVAQQYPQQGLEYITAEQL 150


>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Length = 266 Back     alignment and structure
>4alk_A ENR, enoyl-[acyl-carrier-protein] reductase [NADPH]; oxidoreductase, short-chain dehydrogenase/reductase superfam fatty acid biosynthesis; HET: NAP E9P GLU; 1.90A {Staphylococcus aureus} PDB: 4alj_A* 4ali_A* 4alm_A 4aln_A 3gr6_A* 3gns_A* 3gnt_A 4all_A* Length = 282 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Length = 293 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Length = 285 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Length = 315 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Length = 261 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 2jjy_A* Length = 280 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Length = 296 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Length = 319 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Length = 265 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Length = 297 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Length = 275 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} Length = 271 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Length = 422 Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Length = 329 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Length = 405 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Length = 269 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 99.91
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 99.9
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 99.88
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 99.88
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.86
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 99.86
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.85
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.85
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.85
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 99.85
3rih_A 293 Short chain dehydrogenase or reductase; structural 99.85
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 99.85
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.84
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 99.84
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.84
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.84
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 99.84
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.84
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.84
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 99.84
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 99.84
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.84
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.84
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 99.84
3imf_A 257 Short chain dehydrogenase; structural genomics, in 99.83
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.83
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.83
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 99.83
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 99.83
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 99.83
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.83
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.83
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 99.83
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 99.83
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 99.83
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 99.83
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 99.83
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.83
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 99.82
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.82
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.82
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 99.82
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 99.82
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 99.82
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.82
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 99.82
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.82
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.82
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.82
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.81
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.81
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 99.81
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.81
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.81
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.81
3cxt_A 291 Dehydrogenase with different specificities; rossma 99.81
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.81
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.81
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.81
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 99.81
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.81
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 99.81
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.81
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.8
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.8
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 99.8
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.8
4dqx_A 277 Probable oxidoreductase protein; structural genomi 99.8
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 99.8
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 99.8
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.8
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 99.8
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.8
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.8
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.8
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.8
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.8
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.8
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.8
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.8
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 99.8
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.8
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.8
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.8
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 99.79
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 99.79
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 99.79
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.79
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.79
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 99.79
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.79
1xkq_A 280 Short-chain reductase family member (5D234); parra 99.79
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.79
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 99.79
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.79
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.79
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.79
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 99.79
1xhl_A 297 Short-chain dehydrogenase/reductase family member 99.79
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.78
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 99.78
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.78
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 99.78
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.78
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.78
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 99.78
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 99.77
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.77
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.77
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.77
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.77
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.77
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.77
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.77
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 99.77
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.77
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 99.77
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.77
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 99.77
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.77
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.77
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 99.77
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 99.77
1spx_A 278 Short-chain reductase family member (5L265); paral 99.77
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.77
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 99.77
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 99.77
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 99.77
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.76
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.76
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 99.76
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.76
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 99.76
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.76
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.76
1xq1_A 266 Putative tropinone reducatse; structural genomics, 99.76
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.76
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 99.76
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.76
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 99.76
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.76
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.76
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.75
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.75
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.75
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.75
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.75
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 99.75
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.75
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.75
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.75
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.74
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.74
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 99.74
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.74
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.74
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.74
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.74
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 99.73
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.73
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 99.73
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.73
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.73
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 99.73
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.73
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.73
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.73
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.73
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.72
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.72
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.72
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.72
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.71
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.71
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.71
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.71
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.71
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 99.71
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.7
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.7
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.7
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 99.7
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 99.7
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.69
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.69
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.69
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.69
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.69
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.68
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 99.68
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.68
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 99.67
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.67
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 99.67
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.66
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.66
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.66
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.66
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 99.66
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 99.64
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.64
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 99.64
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 99.64
4e4y_A 244 Short chain dehydrogenase family protein; structur 99.64
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 99.64
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.62
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.61
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.61
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.61
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.6
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 99.59
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.59
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.59
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.58
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.58
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.58
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.54
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 99.54
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.54
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.53
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.52
2yut_A 207 Putative short-chain oxidoreductase; alpha and bet 99.5
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 99.48
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.47
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.42
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.42
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 99.4
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.36
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.36
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.34
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.33
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.32
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.31
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 99.31
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.29
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.29
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.28
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 99.28
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.28
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.27
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.26
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.26
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 99.26
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.26
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 99.26
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 99.25
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.25
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 99.25
1xq6_A 253 Unknown protein; structural genomics, protein stru 99.23
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.23
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.23
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.23
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.22
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.22
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.22
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.21
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.2
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.19
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.19
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.19
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 99.18
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 99.17
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.16
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.16
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.15
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.15
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.15
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.15
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.13
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.13
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.12
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.12
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.11
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 99.11
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 99.1
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 99.09
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.09
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.09
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.09
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.08
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.08
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.07
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.07
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.06
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.05
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.05
2gk4_A 232 Conserved hypothetical protein; alpha-beta-alpha s 99.05
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 99.03
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 99.01
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.01
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.0
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 99.0
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.0
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.0
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 98.98
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 98.97
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 98.96
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.96
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.95
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 98.95
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 98.94
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.94
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 98.94
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 98.93
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 98.93
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 98.91
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 98.87
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 98.87
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 98.86
4f6l_B 508 AUSA reductase domain protein; thioester reductase 98.85
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 98.83
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.81
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.79
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 98.77
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 98.73
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 98.72
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 98.71
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 98.68
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.6
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.57
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.52
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.5
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.48
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.46
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.38
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.33
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.29
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.27
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.26
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 98.25
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.25
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.24
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 98.24
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 98.24
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 98.2
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 98.19
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 98.18
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 98.17
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 98.17
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 98.08
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 98.06
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 98.06
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.01
3gms_A 340 Putative NADPH:quinone reductase; structural genom 97.97
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.97
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.92
4eye_A342 Probable oxidoreductase; structural genomics, niai 97.91
1p9o_A 313 Phosphopantothenoylcysteine synthetase; ligase; 2. 97.88
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.88
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.86
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.85
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.84
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.78
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 97.77
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.77
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.75
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.74
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.72
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 97.7
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.66
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.65
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 97.62
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.61
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.61
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 97.6
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.58
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.5
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.49
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.45
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.44
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.43
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.38
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.37
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 97.36
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.32
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.29
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.29
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 97.26
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 97.24
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.21
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 97.19
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 97.16
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 97.15
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.11
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.11
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 97.11
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 97.04
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 97.03
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 96.97
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.96
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 96.95
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.93
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.92
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.92
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.91
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.91
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 96.91
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 96.9
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.9
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.88
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 96.84
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.82
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.82
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 96.8
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 96.8
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 96.79
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 96.77
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.7
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 96.68
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.68
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 96.66
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.61
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 96.6
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 96.58
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 96.52
2l82_A162 Designed protein OR32; structural genomics, northe 96.51
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.5
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.44
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.38
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.31
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.31
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 96.29
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 96.28
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 96.23
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 96.23
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 96.17
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.15
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.14
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.13
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.1
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 96.1
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 96.09
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 96.03
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.01
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.93
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 95.93
3p2o_A285 Bifunctional protein fold; structural genomics, ce 95.81
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 95.76
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 95.76
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 95.74
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 95.69
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 95.67
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.67
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.67
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 95.65
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 95.64
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 95.58
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.58
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 95.56
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.53
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 95.5
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 95.46
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 95.38
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 95.36
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.35
3qha_A 296 Putative oxidoreductase; seattle structural genomi 95.33
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.28
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.27
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 95.24
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.21
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.16
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.11
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 95.06
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 94.99
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 94.99
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 94.93
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.93
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 94.83
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 94.77
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 94.75
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 94.75
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 94.74
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 94.74
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 94.67
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 94.63
4g65_A 461 TRK system potassium uptake protein TRKA; structur 94.62
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 94.61
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 94.6
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 94.6
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.6
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 94.58
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 94.58
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 94.54
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 94.48
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.42
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.28
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 94.25
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 94.25
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 94.22
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 94.12
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 94.07
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.06
1lnq_A 336 MTHK channels, potassium channel related protein; 94.0
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 93.91
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 93.91
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 93.87
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 93.85
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.84
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 93.83
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.73
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=99.91  E-value=1e-23  Score=154.55  Aligned_cols=106  Identities=27%  Similarity=0.439  Sum_probs=94.9

Q ss_pred             CCCCCEEEEecCCChHHHHHHHHHHHcCCcEEEEecCCCChHHHHHHHHHHHhccCCCCCCceEEEecCCChHHHHHHHH
Q 044851           37 KLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVVD  116 (149)
Q Consensus        37 ~~~~~~~litG~s~gig~~~a~~L~~~g~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~  116 (149)
                      .++||++|||||++|||+++|++|++.|++|++++|+   .+.+++..+++..    .+.++.++.+|++++++++++++
T Consensus         4 sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~~---~~~~~~~~~~i~~----~g~~~~~~~~Dvt~~~~v~~~~~   76 (254)
T 4fn4_A            4 SLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELL---EDRLNQIVQELRG----MGKEVLGVKADVSKKKDVEEFVR   76 (254)
T ss_dssp             GGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESC---HHHHHHHHHHHHH----TTCCEEEEECCTTSHHHHHHHHH
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECC---HHHHHHHHHHHHh----cCCcEEEEEccCCCHHHHHHHHH
Confidence            5899999999999999999999999999999999997   5566677777766    56788999999999999999999


Q ss_pred             HHHHhcCCccEEEeCCcCCCCCCCCCCCCCCCC
Q 044851          117 EVVNAYDRIDILVNNAAEQYECGSVEDIDESRL  149 (149)
Q Consensus       117 ~~~~~~g~id~li~~ag~~~~~~~~~~~s~~~~  149 (149)
                      ++.+++|+||+||||||+.....++.+++.++|
T Consensus        77 ~~~~~~G~iDiLVNNAGi~~~~~~~~~~~~e~~  109 (254)
T 4fn4_A           77 RTFETYSRIDVLCNNAGIMDGVTPVAEVSDELW  109 (254)
T ss_dssp             HHHHHHSCCCEEEECCCCCCTTCCGGGCCHHHH
T ss_pred             HHHHHcCCCCEEEECCcccCCCCChhhCCHHHH
Confidence            999999999999999998765578999887765



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1zk4a1 251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 1e-24
d1spxa_ 264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 2e-24
d2d1ya1 248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 3e-24
d2ew8a1 247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 3e-24
d1vl8a_ 251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 9e-24
d1xkqa_ 272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 2e-23
d1xhla_ 274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 3e-23
d1iy8a_ 258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 5e-23
d1nffa_ 244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 9e-23
d1zmta1 252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 2e-22
d1yxma1 297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 2e-22
d1hxha_ 253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 3e-22
d1ulsa_ 242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 4e-22
d1xg5a_ 257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 6e-22
d1ydea1 250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 7e-22
d1ae1a_ 258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 7e-22
d1g0oa_ 272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 2e-21
d1xq1a_ 259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 2e-21
d1mxha_ 266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-21
d2bgka1 268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 4e-21
d1h5qa_ 260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 8e-21
d1ja9a_ 259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 9e-21
d1fmca_ 255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 1e-20
d2gdza1 254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 2e-20
d1gz6a_ 302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 2e-20
d2ae2a_ 259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-19
d2a4ka1 241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 2e-19
d1hdca_ 254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 2e-19
d1w6ua_ 294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 2e-19
d1geea_ 261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 3e-19
d1x1ta1 260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 2e-18
d1yb1a_ 244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 3e-18
d1cyda_ 242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 5e-18
d1bdba_ 276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 6e-18
d1gega_ 255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 2e-17
d2rhca1 257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 5e-17
d1pr9a_ 244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 6e-17
d1zema1 260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 7e-17
d1e7wa_ 284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 9e-17
d1uzma1 237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 9e-17
d1o5ia_ 234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-16
d1k2wa_ 256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 1e-16
d1sbya1 254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-16
d1ulua_ 256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 3e-16
d1dhra_ 236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-15
d1edoa_ 244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-14
d1q7ba_ 243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-14
d1wmaa1 275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 2e-14
d2ag5a1 245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 2e-14
d1fjha_ 257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 3e-14
d1oaaa_ 259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 4e-14
d1yo6a1 250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 4e-14
d2bd0a1 240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 5e-14
d1xu9a_ 269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 6e-14
d1qsga_ 258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 6e-14
d2pd4a1 274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 7e-14
d2c07a1 251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 8e-14
d1ooea_ 235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-12
d2o23a1 248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 2e-12
d2h7ma1 268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 6e-11
d1uh5a_ 329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 1e-10
d1d7oa_ 297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 2e-10
d1uaya_ 241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 6e-10
d1jtva_ 285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 9e-10
d2fr1a1 259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 1e-08
d1jaya_ 212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 3e-08
d1snya_ 248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 1e-06
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 2e-06
d1udca_ 338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 0.003
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: R-specific alcohol dehydrogenase
species: Lactobacillus brevis [TaxId: 1580]
 Score = 93.1 bits (231), Expect = 1e-24
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 9/112 (8%)

Query: 35  SNKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPD 94
           SN+L G VA++TGG  GIG A+   F +EGA V  T       + A +++    + +   
Sbjct: 1   SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQ--- 57

Query: 95  AKDPMAISADLGFDENCKRVVDEVVNAYDRIDILVNNAAEQYECGSVEDIDE 146
                    D   ++   ++ D    A+  +  LVNNA       SVE+   
Sbjct: 58  -----FFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAG-IAVNKSVEETTT 103


>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.89
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.89
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 99.89
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 99.89
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 99.89
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 99.89
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.88
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 99.88
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.88
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.88
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 99.88
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.88
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.88
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.88
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.87
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.87
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.87
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 99.87
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.87
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.87
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.87
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.87
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.86
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 99.86
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 99.86
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.86
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 99.86
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.86
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.85
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.85
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.85
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.85
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.85
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.85
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 99.85
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.85
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 99.84
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.84
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.82
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.81
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.81
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.81
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.81
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.81
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.79
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 99.79
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.78
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.77
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.76
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 99.76
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.75
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.74
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 99.71
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.71
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.7
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 99.69
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.68
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.61
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.61
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.6
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.58
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.58
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 99.56
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.52
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 99.51
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.27
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.22
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.2
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.2
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.19
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.17
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.17
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.15
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.11
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.08
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.0
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.91
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.9
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.88
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.84
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.81
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.79
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.77
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 98.75
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.75
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.69
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.66
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.63
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 98.58
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.53
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.53
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.48
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.39
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.37
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.23
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.15
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.12
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 97.98
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.88
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.83
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.78
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.67
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.66
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.62
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.6
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.59
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 97.57
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.55
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.54
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.52
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.51
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.43
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.38
d1u7za_ 223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.36
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.34
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.27
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.1
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.09
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 97.03
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.95
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.92
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.9
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 96.9
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.9
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.88
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.87
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.85
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.83
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.8
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.78
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.71
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.62
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.58
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.58
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.53
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.52
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.48
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 96.31
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.29
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.18
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.17
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.13
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.13
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.08
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.83
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.78
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.73
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.68
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.67
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.66
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.5
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.27
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.2
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 95.17
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 94.99
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.9
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.85
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.84
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.8
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.77
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.72
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.71
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 94.71
d1p9oa_ 290 Phosphopantothenoylcysteine synthetase {Human (Hom 94.62
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.55
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.49
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 94.41
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.33
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 94.19
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 93.8
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.73
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 93.6
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.6
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 93.57
d1kl7a_ 511 Threonine synthase {Baker's yeast (Saccharomyces c 93.46
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 93.39
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.29
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.24
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 93.22
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.22
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 93.14
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.14
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 92.99
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 92.94
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.92
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.92
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.9
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 92.79
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.72
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.59
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 92.53
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.52
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.49
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 92.45
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 92.43
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.42
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.37
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 92.35
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.24
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 92.08
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 92.08
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 92.04
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.01
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 91.87
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 91.83
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.67
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.56
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 91.56
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 91.28
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 91.27
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 91.27
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 91.18
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 91.13
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 90.97
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 90.88
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 90.81
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 90.75
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 90.7
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 90.53
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 90.49
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.48
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 90.08
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 89.94
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 89.93
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 89.91
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 89.69
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 89.68
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 89.62
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 89.53
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 89.51
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 89.5
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.41
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.32
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 88.95
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 88.92
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.86
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 88.7
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 88.7
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 88.61
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 88.42
d1qh8b_519 Nitrogenase iron-molybdenum protein, beta chain {K 88.13
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 87.84
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 87.79
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 87.78
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 87.58
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 87.39
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 87.32
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.17
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 87.11
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 87.03
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 87.0
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 86.95
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.63
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 86.36
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 86.12
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 85.96
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 85.62
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 85.54
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 85.5
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 85.28
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 85.25
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 85.01
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 84.9
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 84.71
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 84.3
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.08
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 83.93
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 83.59
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 83.51
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 83.41
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 83.12
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 83.11
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 82.93
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 82.82
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 82.79
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 82.62
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 82.6
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 82.46
d2ax3a2211 Hypothetical protein TM0922, N-terminal domain {Th 82.26
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 81.99
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 81.96
d1m1na_477 Nitrogenase iron-molybdenum protein, alpha chain { 81.86
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 81.6
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 81.44
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 81.26
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 81.2
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 81.16
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 80.79
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 80.69
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 80.56
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 80.52
d1m1nb_522 Nitrogenase iron-molybdenum protein, beta chain {A 80.41
d1miob_457 Nitrogenase iron-molybdenum protein, beta chain {C 80.37
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 80.26
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Gluconate 5-dehydrogenase
species: Thermotoga maritima [TaxId: 2336]
Probab=99.89  E-value=2e-23  Score=151.05  Aligned_cols=107  Identities=28%  Similarity=0.438  Sum_probs=92.2

Q ss_pred             CCCCCCEEEEecCCChHHHHHHHHHHHcCCcEEEEecCCCChHHHHHHHHHHHhccCCCCCCceEEEecCCChHHHHHHH
Q 044851           36 NKLRGMVALVTGGDSGIGRAVCHCFAQEGATVAFTYVKPQEDKDAKETLEMLREAKTPDAKDPMAISADLGFDENCKRVV  115 (149)
Q Consensus        36 ~~~~~~~~litG~s~gig~~~a~~L~~~g~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~  115 (149)
                      +.++||++|||||++|||+++|++|++.|++|++++|+   .+++.+..+++...   .+.++.++.+|+++++++++++
T Consensus         1 f~l~gK~~lITGas~GIG~aia~~la~~Ga~V~i~~r~---~~~~~~~~~~l~~~---~g~~~~~~~~Dv~~~~~v~~~~   74 (251)
T d1vl8a_           1 FDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN---LEEASEAAQKLTEK---YGVETMAFRCDVSNYEEVKKLL   74 (251)
T ss_dssp             CCCTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESC---HHHHHHHHHHHHHH---HCCCEEEEECCTTCHHHHHHHH
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHCCCEEEEEECC---HHHHHHHHHHHHHH---hCCcEEEEEccCCCHHHHHHHH
Confidence            45899999999999999999999999999999999997   45555555555432   3567888999999999999999


Q ss_pred             HHHHHhcCCccEEEeCCcCCCCCCCCCCCCCCCC
Q 044851          116 DEVVNAYDRIDILVNNAAEQYECGSVEDIDESRL  149 (149)
Q Consensus       116 ~~~~~~~g~id~li~~ag~~~~~~~~~~~s~~~~  149 (149)
                      +++.+++|+||+||||||+... +++.+++.++|
T Consensus        75 ~~~~~~~g~iDiLVnnAG~~~~-~~~~~~~~e~~  107 (251)
T d1vl8a_          75 EAVKEKFGKLDTVVNAAGINRR-HPAEEFPLDEF  107 (251)
T ss_dssp             HHHHHHHSCCCEEEECCCCCCC-CCGGGCCHHHH
T ss_pred             HHHHHHcCCCCEEEECCCCCCC-CChhhCCHHHH
Confidence            9999999999999999998765 78988887764



>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qh8b_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m1nb_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1miob_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure