Query         044862
Match_columns 173
No_of_seqs    125 out of 198
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 07:27:46 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044862.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044862hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02704 GASA:  Gibberellin reg 100.0   1E-29 2.2E-34  178.7   5.2   56  117-173     1-60  (60)
  2 PF09257 BCMA-Tall_bind:  BCMA,  75.0     2.1 4.6E-05   28.6   1.7   21  121-141    16-36  (39)
  3 PF01826 TIL:  Trypsin Inhibito  42.4    0.53 1.2E-05   30.5  -5.6   41  116-160     8-49  (55)
  4 PF15079 DUF4546:  Domain of un  27.3      21 0.00046   30.8   0.1   18  135-152   169-187 (205)
  5 PF00322 Endothelin:  Endotheli  23.8      27  0.0006   22.4   0.1   17  125-141     5-22  (31)
  6 PF08115 Toxin_28:  SFI toxin f  23.1      25 0.00054   23.1  -0.2    9  140-148    16-24  (35)
  7 smart00272 END Endothelin.      23.0      38 0.00082   20.9   0.6   16  125-140     1-17  (26)
  8 PF02723 NS3_envE:  Non-structu  19.1      64  0.0014   24.3   1.2   18  135-152    36-56  (82)
  9 PF07974 EGF_2:  EGF-like domai  16.8      74  0.0016   19.5   0.9   13  143-156    18-30  (32)
 10 PF03692 CxxCxxCC:  Putative zi  16.3      48   0.001   22.3  -0.0    9  135-144     2-10  (85)

No 1  
>PF02704 GASA:  Gibberellin regulated protein;  InterPro: IPR003854 This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds.
Probab=99.96  E-value=1e-29  Score=178.69  Aligned_cols=56  Identities=61%  Similarity=1.377  Sum_probs=54.9

Q ss_pred             CChHHHHHHHhhcCCccHHHHHHHhhcCCccccCCCCCCCcCCCcccccC----CCCCCCC
Q 044862          117 DCIPLCAARCKAHSRPNIFGRACTTCCVRCKCVPPGTYGNREKCGKCYTG----GNKPKCP  173 (173)
Q Consensus       117 dC~~~C~~RCs~~sr~k~CmraC~~CC~kC~CVPpGTyGNkeeCPpCY~d----~G~pKCP  173 (173)
                      ||+++|++||++++++++|||+||+||++|+|||+|||||+|+|+ ||+|    +|++|||
T Consensus         1 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~gn~~~Cp-CY~~m~t~~g~pKCP   60 (60)
T PF02704_consen    1 DCGGACSVRCSKASRKKRCMRACGTCCAKCKCVPPGTYGNKEECP-CYRDMKTHGGKPKCP   60 (60)
T ss_pred             CcchHHHHHHhccCCchHHHHHHHHHhccCcccCCCCCCCCccCC-ChhhhhccCCCCCCc
Confidence            799999999999999999999999999999999999999999997 9999    9999998


No 2  
>PF09257 BCMA-Tall_bind:  BCMA, TALL-1 binding;  InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 2KN1_A 1OQD_R 1XU2_T.
Probab=75.01  E-value=2.1  Score=28.57  Aligned_cols=21  Identities=29%  Similarity=0.640  Sum_probs=16.8

Q ss_pred             HHHHHHhhcCCccHHHHHHHh
Q 044862          121 LCAARCKAHSRPNIFGRACTT  141 (173)
Q Consensus       121 ~C~~RCs~~sr~k~CmraC~~  141 (173)
                      -|..|||++.-.-.|.+||+.
T Consensus        16 PChLRCsn~tPP~~Cq~YCna   36 (39)
T PF09257_consen   16 PCHLRCSNNTPPLPCQRYCNA   36 (39)
T ss_dssp             EHHHHHTSSS--TTTHHHHHH
T ss_pred             cceeecCCCCCCccchhhccc
Confidence            388999998888899999985


No 3  
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=42.43  E-value=0.53  Score=30.55  Aligned_cols=41  Identities=29%  Similarity=0.820  Sum_probs=30.3

Q ss_pred             CCChHHHHHHHhhcCCccHHHHHHHhhcCCccccCCCCCCCcC-CC
Q 044862          116 KDCIPLCAARCKAHSRPNIFGRACTTCCVRCKCVPPGTYGNRE-KC  160 (173)
Q Consensus       116 ~dC~~~C~~RCs~~sr~k~CmraC~~CC~kC~CVPpGTyGNke-eC  160 (173)
                      .+|+..|...|+.......|.   ..|=.-|.| +.|++-|.+ .|
T Consensus         8 ~~C~~~C~~tC~~~~~~~~C~---~~C~~gC~C-~~G~v~~~~~~C   49 (55)
T PF01826_consen    8 SECGSPCPRTCDNPNNPEPCS---EPCVEGCFC-PPGYVRNDNGRC   49 (55)
T ss_dssp             ESSETSTTCBSSCTTTSSSCS---SS-ESEEEE-TTTEEEETTSEE
T ss_pred             CcccCCcCCcCCCCCCCcCcC---CCCCccCCC-CCCeeEcCCCCE
Confidence            478889999999877776677   455556889 889887665 44


No 4  
>PF15079 DUF4546:  Domain of unknown function (DUF4546)
Probab=27.31  E-value=21  Score=30.85  Aligned_cols=18  Identities=33%  Similarity=0.912  Sum_probs=13.5

Q ss_pred             HHHHHHhhcCCcc-ccCCC
Q 044862          135 FGRACTTCCVRCK-CVPPG  152 (173)
Q Consensus       135 CmraC~~CC~kC~-CVPpG  152 (173)
                      .+-.|++||++|. |.--.
T Consensus       169 ~lH~C~tCcekcllCalk~  187 (205)
T PF15079_consen  169 SLHQCRTCCEKCLLCALKN  187 (205)
T ss_pred             chhhchhhhhhhhhhhccc
Confidence            5667999999998 64433


No 5  
>PF00322 Endothelin:  Endothelin family;  InterPro: IPR001928 Endothelins (ET's) are the most potent vasoconstrictors known [, , ]. They stimulate cardiac contraction, regulate release of vasoactive substances, and stimulate mitogenesis in blood vessels in primary culture. They also stimulate contraction in almost all other smooth muscles (e.g., uterus, bronchus, vas deferensa and stomach) and stimulate secretion in several tissues (e.g., kidney, liver and adrenals). Endothelin receptors have also been found in the brain, e.g. cerebral cortex, cerebellum and glial cells. Endothelins have been implicated in a variety of pathophysiological conditions associated with stress, including hypertension, myocardial infarction, subarachnoid haemorrhage and renal failure. Endothelins are synthesised by proteolysis of large preproendothelins, which are cleaved to 'big endothelins' before being processed to the mature peptide. Sarafotoxins (SRTX) and bibrotoxin (BTX) are cardiotoxins from the venom of snakes of the Atractaspis family, structurally and functionally [, ] similar to endothelin. As shown in the following schematic representation, these peptides which are 21 residues long contain two intramolecular disulphide bonds.  +-------------+ | | CxCxxxxxxxCxxxCxxxxxx | | +-------+ 'C': conserved cysteine involved in a disulphide bond.  ; GO: 0019229 regulation of vasoconstriction, 0005576 extracellular region; PDB: 1V6R_A 1T7H_A 1EDP_A 1EDN_A 3CMH_A 6CMH_A 1SRB_A 2LDF_A.
Probab=23.83  E-value=27  Score=22.40  Aligned_cols=17  Identities=24%  Similarity=0.335  Sum_probs=12.1

Q ss_pred             HHh-hcCCccHHHHHHHh
Q 044862          125 RCK-AHSRPNIFGRACTT  141 (173)
Q Consensus       125 RCs-~~sr~k~CmraC~~  141 (173)
                      ||| .+..-+.|+.||..
T Consensus         5 RCsC~s~~DkeC~yFChl   22 (31)
T PF00322_consen    5 RCSCASWKDKECVYFCHL   22 (31)
T ss_dssp             -ECCSSSTHHHHHHHHHC
T ss_pred             ceecCCCcchhhheeecc
Confidence            888 45567789999963


No 6  
>PF08115 Toxin_28:  SFI toxin family;  InterPro: IPR012633 This family consists of the SFI family of spider toxins. This family of toxins might share structural, evolutionary and functional relationships with other small, highly structurally constrained spider neurotoxins. These toxins are highly selective agonists/antagonists of different voltage-dependent calcium channels and are extremely valuable reagents in the analysis of neuromuscular function.; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=23.13  E-value=25  Score=23.10  Aligned_cols=9  Identities=44%  Similarity=1.512  Sum_probs=7.5

Q ss_pred             HhhcCCccc
Q 044862          140 TTCCVRCKC  148 (173)
Q Consensus       140 ~~CC~kC~C  148 (173)
                      |-|||+|+|
T Consensus        16 n~~~G~CL~   24 (35)
T PF08115_consen   16 NDCCGSCLC   24 (35)
T ss_pred             CCcccceec
Confidence            458999999


No 7  
>smart00272 END Endothelin.
Probab=23.01  E-value=38  Score=20.90  Aligned_cols=16  Identities=19%  Similarity=0.534  Sum_probs=10.6

Q ss_pred             HHh-hcCCccHHHHHHH
Q 044862          125 RCK-AHSRPNIFGRACT  140 (173)
Q Consensus       125 RCs-~~sr~k~CmraC~  140 (173)
                      ||+ .++.-+.|+.||-
T Consensus         1 RC~C~s~~Dk~C~~FCh   17 (26)
T smart00272        1 RCQCSSATDKACAYFCH   17 (26)
T ss_pred             CcccCCCCChHHHHHhc
Confidence            555 3456677888884


No 8  
>PF02723 NS3_envE:  Non-structural protein NS3/Small envelope protein E;  InterPro: IPR003873 This is a family of small nonstructural proteins, well conserved among Coronavirus strains. This protein is also found in Murine hepatitis virus as small envelope protein E.; GO: 0016020 membrane
Probab=19.08  E-value=64  Score=24.32  Aligned_cols=18  Identities=28%  Similarity=0.691  Sum_probs=13.8

Q ss_pred             HHHHHHhhcCCcc---ccCCC
Q 044862          135 FGRACTTCCVRCK---CVPPG  152 (173)
Q Consensus       135 CmraC~~CC~kC~---CVPpG  152 (173)
                      +++.|..||+-|+   +.|..
T Consensus        36 ~IqLC~~cc~~~n~~v~~P~~   56 (82)
T PF02723_consen   36 LIQLCFQCCRLCNTTVYKPVI   56 (82)
T ss_pred             HHHHHHHHhhhhcceEecccH
Confidence            6788999999998   45543


No 9  
>PF07974 EGF_2:  EGF-like domain;  InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length. This entry contains EGF domains found in a variety of extracellular and membrane proteins
Probab=16.83  E-value=74  Score=19.54  Aligned_cols=13  Identities=46%  Similarity=1.086  Sum_probs=11.2

Q ss_pred             cCCccccCCCCCCC
Q 044862          143 CVRCKCVPPGTYGN  156 (173)
Q Consensus       143 C~kC~CVPpGTyGN  156 (173)
                      +++|.| .+|.+|.
T Consensus        18 ~g~C~C-~~g~~G~   30 (32)
T PF07974_consen   18 CGRCVC-DSGYTGP   30 (32)
T ss_pred             CCEEEC-CCCCcCC
Confidence            789999 8888885


No 10 
>PF03692 CxxCxxCC:  Putative zinc- or iron-chelating domain;  InterPro: IPR005358 This family of proteins contain 8 conserved cysteines that may form a zinc binding site. The function of these proteins is unknown.
Probab=16.27  E-value=48  Score=22.31  Aligned_cols=9  Identities=33%  Similarity=1.173  Sum_probs=6.9

Q ss_pred             HHHHHHhhcC
Q 044862          135 FGRACTTCCV  144 (173)
Q Consensus       135 CmraC~~CC~  144 (173)
                      |.+ ||.||.
T Consensus         2 C~~-Cg~CC~   10 (85)
T PF03692_consen    2 CRQ-CGACCR   10 (85)
T ss_pred             ccc-HhHHHc
Confidence            566 888887


Done!