Query 044862
Match_columns 173
No_of_seqs 125 out of 198
Neff 2.5
Searched_HMMs 46136
Date Fri Mar 29 07:27:46 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044862.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044862hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF02704 GASA: Gibberellin reg 100.0 1E-29 2.2E-34 178.7 5.2 56 117-173 1-60 (60)
2 PF09257 BCMA-Tall_bind: BCMA, 75.0 2.1 4.6E-05 28.6 1.7 21 121-141 16-36 (39)
3 PF01826 TIL: Trypsin Inhibito 42.4 0.53 1.2E-05 30.5 -5.6 41 116-160 8-49 (55)
4 PF15079 DUF4546: Domain of un 27.3 21 0.00046 30.8 0.1 18 135-152 169-187 (205)
5 PF00322 Endothelin: Endotheli 23.8 27 0.0006 22.4 0.1 17 125-141 5-22 (31)
6 PF08115 Toxin_28: SFI toxin f 23.1 25 0.00054 23.1 -0.2 9 140-148 16-24 (35)
7 smart00272 END Endothelin. 23.0 38 0.00082 20.9 0.6 16 125-140 1-17 (26)
8 PF02723 NS3_envE: Non-structu 19.1 64 0.0014 24.3 1.2 18 135-152 36-56 (82)
9 PF07974 EGF_2: EGF-like domai 16.8 74 0.0016 19.5 0.9 13 143-156 18-30 (32)
10 PF03692 CxxCxxCC: Putative zi 16.3 48 0.001 22.3 -0.0 9 135-144 2-10 (85)
No 1
>PF02704 GASA: Gibberellin regulated protein; InterPro: IPR003854 This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds.
Probab=99.96 E-value=1e-29 Score=178.69 Aligned_cols=56 Identities=61% Similarity=1.377 Sum_probs=54.9
Q ss_pred CChHHHHHHHhhcCCccHHHHHHHhhcCCccccCCCCCCCcCCCcccccC----CCCCCCC
Q 044862 117 DCIPLCAARCKAHSRPNIFGRACTTCCVRCKCVPPGTYGNREKCGKCYTG----GNKPKCP 173 (173)
Q Consensus 117 dC~~~C~~RCs~~sr~k~CmraC~~CC~kC~CVPpGTyGNkeeCPpCY~d----~G~pKCP 173 (173)
||+++|++||++++++++|||+||+||++|+|||+|||||+|+|+ ||+| +|++|||
T Consensus 1 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~gn~~~Cp-CY~~m~t~~g~pKCP 60 (60)
T PF02704_consen 1 DCGGACSVRCSKASRKKRCMRACGTCCAKCKCVPPGTYGNKEECP-CYRDMKTHGGKPKCP 60 (60)
T ss_pred CcchHHHHHHhccCCchHHHHHHHHHhccCcccCCCCCCCCccCC-ChhhhhccCCCCCCc
Confidence 799999999999999999999999999999999999999999997 9999 9999998
No 2
>PF09257 BCMA-Tall_bind: BCMA, TALL-1 binding; InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors. Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 2KN1_A 1OQD_R 1XU2_T.
Probab=75.01 E-value=2.1 Score=28.57 Aligned_cols=21 Identities=29% Similarity=0.640 Sum_probs=16.8
Q ss_pred HHHHHHhhcCCccHHHHHHHh
Q 044862 121 LCAARCKAHSRPNIFGRACTT 141 (173)
Q Consensus 121 ~C~~RCs~~sr~k~CmraC~~ 141 (173)
-|..|||++.-.-.|.+||+.
T Consensus 16 PChLRCsn~tPP~~Cq~YCna 36 (39)
T PF09257_consen 16 PCHLRCSNNTPPLPCQRYCNA 36 (39)
T ss_dssp EHHHHHTSSS--TTTHHHHHH
T ss_pred cceeecCCCCCCccchhhccc
Confidence 388999998888899999985
No 3
>PF01826 TIL: Trypsin Inhibitor like cysteine rich domain; InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are: chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=42.43 E-value=0.53 Score=30.55 Aligned_cols=41 Identities=29% Similarity=0.820 Sum_probs=30.3
Q ss_pred CCChHHHHHHHhhcCCccHHHHHHHhhcCCccccCCCCCCCcC-CC
Q 044862 116 KDCIPLCAARCKAHSRPNIFGRACTTCCVRCKCVPPGTYGNRE-KC 160 (173)
Q Consensus 116 ~dC~~~C~~RCs~~sr~k~CmraC~~CC~kC~CVPpGTyGNke-eC 160 (173)
.+|+..|...|+.......|. ..|=.-|.| +.|++-|.+ .|
T Consensus 8 ~~C~~~C~~tC~~~~~~~~C~---~~C~~gC~C-~~G~v~~~~~~C 49 (55)
T PF01826_consen 8 SECGSPCPRTCDNPNNPEPCS---EPCVEGCFC-PPGYVRNDNGRC 49 (55)
T ss_dssp ESSETSTTCBSSCTTTSSSCS---SS-ESEEEE-TTTEEEETTSEE
T ss_pred CcccCCcCCcCCCCCCCcCcC---CCCCccCCC-CCCeeEcCCCCE
Confidence 478889999999877776677 455556889 889887665 44
No 4
>PF15079 DUF4546: Domain of unknown function (DUF4546)
Probab=27.31 E-value=21 Score=30.85 Aligned_cols=18 Identities=33% Similarity=0.912 Sum_probs=13.5
Q ss_pred HHHHHHhhcCCcc-ccCCC
Q 044862 135 FGRACTTCCVRCK-CVPPG 152 (173)
Q Consensus 135 CmraC~~CC~kC~-CVPpG 152 (173)
.+-.|++||++|. |.--.
T Consensus 169 ~lH~C~tCcekcllCalk~ 187 (205)
T PF15079_consen 169 SLHQCRTCCEKCLLCALKN 187 (205)
T ss_pred chhhchhhhhhhhhhhccc
Confidence 5667999999998 64433
No 5
>PF00322 Endothelin: Endothelin family; InterPro: IPR001928 Endothelins (ET's) are the most potent vasoconstrictors known [, , ]. They stimulate cardiac contraction, regulate release of vasoactive substances, and stimulate mitogenesis in blood vessels in primary culture. They also stimulate contraction in almost all other smooth muscles (e.g., uterus, bronchus, vas deferensa and stomach) and stimulate secretion in several tissues (e.g., kidney, liver and adrenals). Endothelin receptors have also been found in the brain, e.g. cerebral cortex, cerebellum and glial cells. Endothelins have been implicated in a variety of pathophysiological conditions associated with stress, including hypertension, myocardial infarction, subarachnoid haemorrhage and renal failure. Endothelins are synthesised by proteolysis of large preproendothelins, which are cleaved to 'big endothelins' before being processed to the mature peptide. Sarafotoxins (SRTX) and bibrotoxin (BTX) are cardiotoxins from the venom of snakes of the Atractaspis family, structurally and functionally [, ] similar to endothelin. As shown in the following schematic representation, these peptides which are 21 residues long contain two intramolecular disulphide bonds. +-------------+ | | CxCxxxxxxxCxxxCxxxxxx | | +-------+ 'C': conserved cysteine involved in a disulphide bond. ; GO: 0019229 regulation of vasoconstriction, 0005576 extracellular region; PDB: 1V6R_A 1T7H_A 1EDP_A 1EDN_A 3CMH_A 6CMH_A 1SRB_A 2LDF_A.
Probab=23.83 E-value=27 Score=22.40 Aligned_cols=17 Identities=24% Similarity=0.335 Sum_probs=12.1
Q ss_pred HHh-hcCCccHHHHHHHh
Q 044862 125 RCK-AHSRPNIFGRACTT 141 (173)
Q Consensus 125 RCs-~~sr~k~CmraC~~ 141 (173)
||| .+..-+.|+.||..
T Consensus 5 RCsC~s~~DkeC~yFChl 22 (31)
T PF00322_consen 5 RCSCASWKDKECVYFCHL 22 (31)
T ss_dssp -ECCSSSTHHHHHHHHHC
T ss_pred ceecCCCcchhhheeecc
Confidence 888 45567789999963
No 6
>PF08115 Toxin_28: SFI toxin family; InterPro: IPR012633 This family consists of the SFI family of spider toxins. This family of toxins might share structural, evolutionary and functional relationships with other small, highly structurally constrained spider neurotoxins. These toxins are highly selective agonists/antagonists of different voltage-dependent calcium channels and are extremely valuable reagents in the analysis of neuromuscular function.; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=23.13 E-value=25 Score=23.10 Aligned_cols=9 Identities=44% Similarity=1.512 Sum_probs=7.5
Q ss_pred HhhcCCccc
Q 044862 140 TTCCVRCKC 148 (173)
Q Consensus 140 ~~CC~kC~C 148 (173)
|-|||+|+|
T Consensus 16 n~~~G~CL~ 24 (35)
T PF08115_consen 16 NDCCGSCLC 24 (35)
T ss_pred CCcccceec
Confidence 458999999
No 7
>smart00272 END Endothelin.
Probab=23.01 E-value=38 Score=20.90 Aligned_cols=16 Identities=19% Similarity=0.534 Sum_probs=10.6
Q ss_pred HHh-hcCCccHHHHHHH
Q 044862 125 RCK-AHSRPNIFGRACT 140 (173)
Q Consensus 125 RCs-~~sr~k~CmraC~ 140 (173)
||+ .++.-+.|+.||-
T Consensus 1 RC~C~s~~Dk~C~~FCh 17 (26)
T smart00272 1 RCQCSSATDKACAYFCH 17 (26)
T ss_pred CcccCCCCChHHHHHhc
Confidence 555 3456677888884
No 8
>PF02723 NS3_envE: Non-structural protein NS3/Small envelope protein E; InterPro: IPR003873 This is a family of small nonstructural proteins, well conserved among Coronavirus strains. This protein is also found in Murine hepatitis virus as small envelope protein E.; GO: 0016020 membrane
Probab=19.08 E-value=64 Score=24.32 Aligned_cols=18 Identities=28% Similarity=0.691 Sum_probs=13.8
Q ss_pred HHHHHHhhcCCcc---ccCCC
Q 044862 135 FGRACTTCCVRCK---CVPPG 152 (173)
Q Consensus 135 CmraC~~CC~kC~---CVPpG 152 (173)
+++.|..||+-|+ +.|..
T Consensus 36 ~IqLC~~cc~~~n~~v~~P~~ 56 (82)
T PF02723_consen 36 LIQLCFQCCRLCNTTVYKPVI 56 (82)
T ss_pred HHHHHHHHhhhhcceEecccH
Confidence 6788999999998 45543
No 9
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length. This entry contains EGF domains found in a variety of extracellular and membrane proteins
Probab=16.83 E-value=74 Score=19.54 Aligned_cols=13 Identities=46% Similarity=1.086 Sum_probs=11.2
Q ss_pred cCCccccCCCCCCC
Q 044862 143 CVRCKCVPPGTYGN 156 (173)
Q Consensus 143 C~kC~CVPpGTyGN 156 (173)
+++|.| .+|.+|.
T Consensus 18 ~g~C~C-~~g~~G~ 30 (32)
T PF07974_consen 18 CGRCVC-DSGYTGP 30 (32)
T ss_pred CCEEEC-CCCCcCC
Confidence 789999 8888885
No 10
>PF03692 CxxCxxCC: Putative zinc- or iron-chelating domain; InterPro: IPR005358 This family of proteins contain 8 conserved cysteines that may form a zinc binding site. The function of these proteins is unknown.
Probab=16.27 E-value=48 Score=22.31 Aligned_cols=9 Identities=33% Similarity=1.173 Sum_probs=6.9
Q ss_pred HHHHHHhhcC
Q 044862 135 FGRACTTCCV 144 (173)
Q Consensus 135 CmraC~~CC~ 144 (173)
|.+ ||.||.
T Consensus 2 C~~-Cg~CC~ 10 (85)
T PF03692_consen 2 CRQ-CGACCR 10 (85)
T ss_pred ccc-HhHHHc
Confidence 566 888887
Done!