Citrus Sinensis ID: 044899


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
SFCFQGLFFCPDAASLLLHNFCIYHIDASGHELGADEIYSDFPLLNVDDLAEQVAEVLDFFGLEKVLCLGVTAGAYILTLFAMKYQERVLGLILVSPICKAPSWTEWLYNKVLMNLLYFYGMCGVLKECLLQRYFSKEFRSGEHGAESDIIQACRRVLDQGQSLNVMHFLQAINERHDLTKGLKELQCKTLIFVGESSPFHTESLHMSATMGSKNCGLVEVQACGSLVTEEYPLAMLIPIELFLMGFGYCKQPNFPSSSSNGPNPTSPLNHSCIAPELLSPESLGIKLKPIKTRADINI
ccccccccccHHHHHHcccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccEEEEECcccccccHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
SFCFQGLFFCPDAASLLLHNFCIYHIDASGHELGADEIYSDFPLLNVDDLAEQVAEVLDFFGLEKVLCLGVTAGAYILTLFAMKYQERVLGLILVSPICKAPSWTEWLYNKVLMNLLYFYGMCGVLKECLLQRYFSKEFRSGEHGAESDIIQACRRVLDQGQSLNVMHFLQAINERHDLTKGLKELQCKTLIFVGESSPFHTESLHMSATMGSKNCGLVEVQACGSLVTEEYPLAMLIPIELFLMGFGYCK**************************************PIKTRAD*N*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SFCFQGLFFCPDAASLLLHNFCIYHIDASGHELGADEIYSDFPLLNVDDLAEQVAEVLDFFGLEKVLCLGVTAGAYILTLFAMKYQERVLGLILVSPICKAPSWTEWLYNKVLMNLLYFYGMCGVLKECLLQRYFSKEFRSGEHGAESDIIQACRRVLDQGQSLNVMHFLQAINERHDLTKGLKELQCKTLIFVGESSPFHTESLHMSATMGSKNCGLVEVQACGSLVTEEYPLAMLIPIELFLMGFGYCKQPNFPSSSSNGPNPTSPLNHSCIAPELLSPESLGIKLKPIKTRADINI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pollen-specific protein SF21 probableO23969

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QMQ, chain A
Confidence level:very confident
Coverage over the Query: 13-245
View the alignment between query and template
View the model in PyMOL
Template: 3G02, chain A
Confidence level:confident
Coverage over the Query: 8-248
View the alignment between query and template
View the model in PyMOL