Query         044928
Match_columns 321
No_of_seqs    80 out of 82
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 08:09:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044928.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044928hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02805 Ada_Zn_binding:  Metal  18.3      54  0.0012   25.8   0.7   12  281-292    17-28  (66)
  2 COG2169 Ada Adenosine deaminas  17.1      65  0.0014   30.0   1.0   12  281-292    25-36  (187)
  3 PF03957 Jun:  Jun-like transcr  10.8      86  0.0019   30.1   0.0   11   50-60    120-130 (237)
  4 PRK15435 bifunctional DNA-bind  10.6 1.3E+02  0.0028   29.7   1.1   12  281-292    26-37  (353)
  5 cd00224 Mog1 homolog to Ran-Bi  10.5   2E+02  0.0044   26.0   2.2   32  250-285     2-34  (173)
  6 cd05480 NRIP_C NRIP_C; putativ   9.7   1E+02  0.0023   26.4   0.1   11   78-88     81-91  (103)
  7 PF06601 Orthopox_F6:  Orthopox   9.3 1.1E+02  0.0024   24.7   0.1   11    1-11     28-38  (72)
  8 COG0686 Ald Alanine dehydrogen   8.1 2.8E+02  0.0061   28.5   2.3   25  266-295   283-308 (371)
  9 PF01644 Chitin_synth_1:  Chiti   7.9 1.9E+02  0.0041   26.3   1.0   13   46-58    124-136 (163)
 10 PHA02106 hypothetical protein    7.5 2.2E+02  0.0049   23.7   1.2   12   15-26     59-70  (91)

No 1  
>PF02805 Ada_Zn_binding:  Metal binding domain of Ada;  InterPro: IPR004026 The Escherichia coli Ada protein repairs O6-methylguanine residues and methyl phosphotriesters in DNA by direct transfer of the methyl group to a cysteine residue. This domain contains four conserved cysteines that form a zinc binding site [, ]. One of these cysteines is a methyl group acceptor. The methylated domain can then specifically bind to the ada box on a DNA duplex [].; GO: 0003677 DNA binding, 0008168 methyltransferase activity, 0008270 zinc ion binding, 0006281 DNA repair, 0006355 regulation of transcription, DNA-dependent; PDB: 1WPK_A 1ZGW_A 1EYF_A 1ADN_A 1U8B_A.
Probab=18.26  E-value=54  Score=25.76  Aligned_cols=12  Identities=33%  Similarity=1.016  Sum_probs=10.6

Q ss_pred             eEEeeecCCCcc
Q 044928          281 QVYYGVRNAGLV  292 (321)
Q Consensus       281 ~~y~~v~~~g~v  292 (321)
                      .+||||++||++
T Consensus        17 ~F~~~v~tT~Iy   28 (66)
T PF02805_consen   17 KFFYGVKTTGIY   28 (66)
T ss_dssp             TBEEEETTTTEE
T ss_pred             CEEEEECcCCEE
Confidence            589999999975


No 2  
>COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism]
Probab=17.11  E-value=65  Score=30.01  Aligned_cols=12  Identities=25%  Similarity=0.667  Sum_probs=10.9

Q ss_pred             eEEeeecCCCcc
Q 044928          281 QVYYGVRNAGLV  292 (321)
Q Consensus       281 ~~y~~v~~~g~v  292 (321)
                      ++||||++||++
T Consensus        25 ~F~~~VkTTGIf   36 (187)
T COG2169          25 QFFVAVKTTGIF   36 (187)
T ss_pred             eEEEEEeeccee
Confidence            799999999975


No 3  
>PF03957 Jun:  Jun-like transcription factor;  InterPro: IPR005643 The c-Jun NH(2)-terminal kinase (JNK) is a member of an evolutionarily conserved sub-family of mitogen-activated protein (MAP) kinases [, ].; PDB: 3U86_B.
Probab=10.80  E-value=86  Score=30.05  Aligned_cols=11  Identities=18%  Similarity=0.156  Sum_probs=0.0

Q ss_pred             chhhhhcCCCC
Q 044928           50 WFFDAINNGAA   60 (321)
Q Consensus        50 WFVDALNsv~~   60 (321)
                      =||+|||..+.
T Consensus       120 GFv~AL~~Lh~  130 (237)
T PF03957_consen  120 GFVKALADLHK  130 (237)
T ss_dssp             -----------
T ss_pred             HHHHHHHHHHh
Confidence            39999999973


No 4  
>PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional
Probab=10.63  E-value=1.3e+02  Score=29.73  Aligned_cols=12  Identities=25%  Similarity=0.695  Sum_probs=10.6

Q ss_pred             eEEeeecCCCcc
Q 044928          281 QVYYGVRNAGLV  292 (321)
Q Consensus       281 ~~y~~v~~~g~v  292 (321)
                      ++||||++||++
T Consensus        26 ~F~~~V~tTgi~   37 (353)
T PRK15435         26 EFVFAVRTTGIF   37 (353)
T ss_pred             eEEEEEeecceE
Confidence            499999999975


No 5  
>cd00224 Mog1 homolog to Ran-Binding Protein Mog1p; binds to the small GTPase Ran, which plays an important role in nuclear import. Binding is independent of Ran's nucleotide state (RanGTP/RanGDP)
Probab=10.46  E-value=2e+02  Score=26.02  Aligned_cols=32  Identities=31%  Similarity=0.580  Sum_probs=20.5

Q ss_pred             ccccceeeeeeecCCCCCC-ceeEEecCCccceEEee
Q 044928          250 QVYGGAVRSVVTMDHSYDQ-PVRVVSADGVNQQVYYG  285 (321)
Q Consensus       250 qvyg~~~r~v~~~~~~~~~-~~~vv~~dg~~q~~y~~  285 (321)
                      +.|||||+-.-|..- -|- -.|-| .|  ||-||-=
T Consensus         2 ~LfGGAI~~~lP~~f-~DvS~lRqV-PD--nQEVF~~   34 (173)
T cd00224           2 PLFGGAFSAILPPGF-IDVSDLRPV-PD--NQEVFCH   34 (173)
T ss_pred             CccCceEEEeCCCcc-cchhcceeC-CC--CcEEEEc
Confidence            579999998776532 110 23666 66  7888853


No 6  
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein. Proteins in this family have been described as probable nuclear receptor interacting proteins. The  C-terminal domain of this family is homologous to the retroviral aspartyl protease domain. The domain is structurally related to one lobe of the pepsin molecule. The conserved active site aspartate occurs within a motif (Asp-Thr/Ser-Gly), as it does in pepsin. Asp residues are ligands of an activated water molecule in all examples where catalytic residues have been identified. This group of aspartate peptidases is classified by MEROPS as the peptidase family A2 (retropepsin family, clan AA), subfamily A2A.
Probab=9.73  E-value=1e+02  Score=26.42  Aligned_cols=11  Identities=18%  Similarity=0.616  Sum_probs=9.2

Q ss_pred             CCCCcccccCC
Q 044928           78 EAPDYLFGLEN   88 (321)
Q Consensus        78 ~npD~LfGLD~   88 (321)
                      ++.|||||||.
T Consensus        81 ~~~d~llGLdm   91 (103)
T cd05480          81 NEKNFSLGLQT   91 (103)
T ss_pred             CCcceEeeHHH
Confidence            46799999994


No 7  
>PF06601 Orthopox_F6:  Orthopoxvirus F6 protein;  InterPro: IPR009521 This family consists of several Orthopoxvirus F6L proteins the function of which is unknown.
Probab=9.31  E-value=1.1e+02  Score=24.67  Aligned_cols=11  Identities=45%  Similarity=0.422  Sum_probs=8.3

Q ss_pred             Chhhhhhhhcc
Q 044928            1 MIEEYDRLAQN   11 (321)
Q Consensus         1 MMeEYDRL~~~   11 (321)
                      ||||||+|...
T Consensus        28 ~ieE~~~Ll~~   38 (72)
T PF06601_consen   28 SIEESDSLLDV   38 (72)
T ss_pred             ehhhhhccCch
Confidence            68899888643


No 8  
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]
Probab=8.05  E-value=2.8e+02  Score=28.54  Aligned_cols=25  Identities=56%  Similarity=0.818  Sum_probs=18.4

Q ss_pred             CCCceeEEecCCccceEEeeecC-CCccCCc
Q 044928          266 YDQPVRVVSADGVNQQVYYGVRN-AGLVPGY  295 (321)
Q Consensus       266 ~~~~~~vv~~dg~~q~~y~~v~~-~g~v~~~  295 (321)
                      .|.|+-.+  ||+   +||+|.| +|.||--
T Consensus       283 h~~PtY~~--~gv---vhY~VaNmPgaVprT  308 (371)
T COG0686         283 HDDPTYEV--DGV---VHYGVANMPGAVPRT  308 (371)
T ss_pred             CCCCceee--cCE---EEEecCCCCccccch
Confidence            44466666  765   8999999 8888753


No 9  
>PF01644 Chitin_synth_1:  Chitin synthase;  InterPro: IPR004834 This region is found commonly in chitin synthases classes I, II and III 2.4.1.16 from EC. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesised on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases []. ; GO: 0004100 chitin synthase activity, 0006031 chitin biosynthetic process
Probab=7.86  E-value=1.9e+02  Score=26.34  Aligned_cols=13  Identities=38%  Similarity=0.920  Sum_probs=10.3

Q ss_pred             CcccchhhhhcCC
Q 044928           46 NREHWFFDAINNG   58 (321)
Q Consensus        46 kseqWFVDALNsv   58 (321)
                      +|..||++|+=..
T Consensus       124 nSHrWfFnaf~~~  136 (163)
T PF01644_consen  124 NSHRWFFNAFCRQ  136 (163)
T ss_pred             chhhHHHHHHHhh
Confidence            5889999987554


No 10 
>PHA02106 hypothetical protein
Probab=7.49  E-value=2.2e+02  Score=23.72  Aligned_cols=12  Identities=42%  Similarity=0.722  Sum_probs=9.0

Q ss_pred             CCceeEEEeecC
Q 044928           15 RSARLRLFLFTK   26 (321)
Q Consensus        15 kpaRLRLFLFP~   26 (321)
                      |--|||||+-..
T Consensus        59 klnrlrlfivsi   70 (91)
T PHA02106         59 KLNRLRLFVVSI   70 (91)
T ss_pred             ccceEEEEEEEE
Confidence            456999998753


Done!