Query 044928
Match_columns 321
No_of_seqs 80 out of 82
Neff 2.9
Searched_HMMs 46136
Date Fri Mar 29 08:09:07 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/044928.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/044928hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF02805 Ada_Zn_binding: Metal 18.3 54 0.0012 25.8 0.7 12 281-292 17-28 (66)
2 COG2169 Ada Adenosine deaminas 17.1 65 0.0014 30.0 1.0 12 281-292 25-36 (187)
3 PF03957 Jun: Jun-like transcr 10.8 86 0.0019 30.1 0.0 11 50-60 120-130 (237)
4 PRK15435 bifunctional DNA-bind 10.6 1.3E+02 0.0028 29.7 1.1 12 281-292 26-37 (353)
5 cd00224 Mog1 homolog to Ran-Bi 10.5 2E+02 0.0044 26.0 2.2 32 250-285 2-34 (173)
6 cd05480 NRIP_C NRIP_C; putativ 9.7 1E+02 0.0023 26.4 0.1 11 78-88 81-91 (103)
7 PF06601 Orthopox_F6: Orthopox 9.3 1.1E+02 0.0024 24.7 0.1 11 1-11 28-38 (72)
8 COG0686 Ald Alanine dehydrogen 8.1 2.8E+02 0.0061 28.5 2.3 25 266-295 283-308 (371)
9 PF01644 Chitin_synth_1: Chiti 7.9 1.9E+02 0.0041 26.3 1.0 13 46-58 124-136 (163)
10 PHA02106 hypothetical protein 7.5 2.2E+02 0.0049 23.7 1.2 12 15-26 59-70 (91)
No 1
>PF02805 Ada_Zn_binding: Metal binding domain of Ada; InterPro: IPR004026 The Escherichia coli Ada protein repairs O6-methylguanine residues and methyl phosphotriesters in DNA by direct transfer of the methyl group to a cysteine residue. This domain contains four conserved cysteines that form a zinc binding site [, ]. One of these cysteines is a methyl group acceptor. The methylated domain can then specifically bind to the ada box on a DNA duplex [].; GO: 0003677 DNA binding, 0008168 methyltransferase activity, 0008270 zinc ion binding, 0006281 DNA repair, 0006355 regulation of transcription, DNA-dependent; PDB: 1WPK_A 1ZGW_A 1EYF_A 1ADN_A 1U8B_A.
Probab=18.26 E-value=54 Score=25.76 Aligned_cols=12 Identities=33% Similarity=1.016 Sum_probs=10.6
Q ss_pred eEEeeecCCCcc
Q 044928 281 QVYYGVRNAGLV 292 (321)
Q Consensus 281 ~~y~~v~~~g~v 292 (321)
.+||||++||++
T Consensus 17 ~F~~~v~tT~Iy 28 (66)
T PF02805_consen 17 KFFYGVKTTGIY 28 (66)
T ss_dssp TBEEEETTTTEE
T ss_pred CEEEEECcCCEE
Confidence 589999999975
No 2
>COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism]
Probab=17.11 E-value=65 Score=30.01 Aligned_cols=12 Identities=25% Similarity=0.667 Sum_probs=10.9
Q ss_pred eEEeeecCCCcc
Q 044928 281 QVYYGVRNAGLV 292 (321)
Q Consensus 281 ~~y~~v~~~g~v 292 (321)
++||||++||++
T Consensus 25 ~F~~~VkTTGIf 36 (187)
T COG2169 25 QFFVAVKTTGIF 36 (187)
T ss_pred eEEEEEeeccee
Confidence 799999999975
No 3
>PF03957 Jun: Jun-like transcription factor; InterPro: IPR005643 The c-Jun NH(2)-terminal kinase (JNK) is a member of an evolutionarily conserved sub-family of mitogen-activated protein (MAP) kinases [, ].; PDB: 3U86_B.
Probab=10.80 E-value=86 Score=30.05 Aligned_cols=11 Identities=18% Similarity=0.156 Sum_probs=0.0
Q ss_pred chhhhhcCCCC
Q 044928 50 WFFDAINNGAA 60 (321)
Q Consensus 50 WFVDALNsv~~ 60 (321)
=||+|||..+.
T Consensus 120 GFv~AL~~Lh~ 130 (237)
T PF03957_consen 120 GFVKALADLHK 130 (237)
T ss_dssp -----------
T ss_pred HHHHHHHHHHh
Confidence 39999999973
No 4
>PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional
Probab=10.63 E-value=1.3e+02 Score=29.73 Aligned_cols=12 Identities=25% Similarity=0.695 Sum_probs=10.6
Q ss_pred eEEeeecCCCcc
Q 044928 281 QVYYGVRNAGLV 292 (321)
Q Consensus 281 ~~y~~v~~~g~v 292 (321)
++||||++||++
T Consensus 26 ~F~~~V~tTgi~ 37 (353)
T PRK15435 26 EFVFAVRTTGIF 37 (353)
T ss_pred eEEEEEeecceE
Confidence 499999999975
No 5
>cd00224 Mog1 homolog to Ran-Binding Protein Mog1p; binds to the small GTPase Ran, which plays an important role in nuclear import. Binding is independent of Ran's nucleotide state (RanGTP/RanGDP)
Probab=10.46 E-value=2e+02 Score=26.02 Aligned_cols=32 Identities=31% Similarity=0.580 Sum_probs=20.5
Q ss_pred ccccceeeeeeecCCCCCC-ceeEEecCCccceEEee
Q 044928 250 QVYGGAVRSVVTMDHSYDQ-PVRVVSADGVNQQVYYG 285 (321)
Q Consensus 250 qvyg~~~r~v~~~~~~~~~-~~~vv~~dg~~q~~y~~ 285 (321)
+.|||||+-.-|..- -|- -.|-| .| ||-||-=
T Consensus 2 ~LfGGAI~~~lP~~f-~DvS~lRqV-PD--nQEVF~~ 34 (173)
T cd00224 2 PLFGGAFSAILPPGF-IDVSDLRPV-PD--NQEVFCH 34 (173)
T ss_pred CccCceEEEeCCCcc-cchhcceeC-CC--CcEEEEc
Confidence 579999998776532 110 23666 66 7888853
No 6
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein. Proteins in this family have been described as probable nuclear receptor interacting proteins. The C-terminal domain of this family is homologous to the retroviral aspartyl protease domain. The domain is structurally related to one lobe of the pepsin molecule. The conserved active site aspartate occurs within a motif (Asp-Thr/Ser-Gly), as it does in pepsin. Asp residues are ligands of an activated water molecule in all examples where catalytic residues have been identified. This group of aspartate peptidases is classified by MEROPS as the peptidase family A2 (retropepsin family, clan AA), subfamily A2A.
Probab=9.73 E-value=1e+02 Score=26.42 Aligned_cols=11 Identities=18% Similarity=0.616 Sum_probs=9.2
Q ss_pred CCCCcccccCC
Q 044928 78 EAPDYLFGLEN 88 (321)
Q Consensus 78 ~npD~LfGLD~ 88 (321)
++.|||||||.
T Consensus 81 ~~~d~llGLdm 91 (103)
T cd05480 81 NEKNFSLGLQT 91 (103)
T ss_pred CCcceEeeHHH
Confidence 46799999994
No 7
>PF06601 Orthopox_F6: Orthopoxvirus F6 protein; InterPro: IPR009521 This family consists of several Orthopoxvirus F6L proteins the function of which is unknown.
Probab=9.31 E-value=1.1e+02 Score=24.67 Aligned_cols=11 Identities=45% Similarity=0.422 Sum_probs=8.3
Q ss_pred Chhhhhhhhcc
Q 044928 1 MIEEYDRLAQN 11 (321)
Q Consensus 1 MMeEYDRL~~~ 11 (321)
||||||+|...
T Consensus 28 ~ieE~~~Ll~~ 38 (72)
T PF06601_consen 28 SIEESDSLLDV 38 (72)
T ss_pred ehhhhhccCch
Confidence 68899888643
No 8
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]
Probab=8.05 E-value=2.8e+02 Score=28.54 Aligned_cols=25 Identities=56% Similarity=0.818 Sum_probs=18.4
Q ss_pred CCCceeEEecCCccceEEeeecC-CCccCCc
Q 044928 266 YDQPVRVVSADGVNQQVYYGVRN-AGLVPGY 295 (321)
Q Consensus 266 ~~~~~~vv~~dg~~q~~y~~v~~-~g~v~~~ 295 (321)
.|.|+-.+ ||+ +||+|.| +|.||--
T Consensus 283 h~~PtY~~--~gv---vhY~VaNmPgaVprT 308 (371)
T COG0686 283 HDDPTYEV--DGV---VHYGVANMPGAVPRT 308 (371)
T ss_pred CCCCceee--cCE---EEEecCCCCccccch
Confidence 44466666 765 8999999 8888753
No 9
>PF01644 Chitin_synth_1: Chitin synthase; InterPro: IPR004834 This region is found commonly in chitin synthases classes I, II and III 2.4.1.16 from EC. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesised on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases []. ; GO: 0004100 chitin synthase activity, 0006031 chitin biosynthetic process
Probab=7.86 E-value=1.9e+02 Score=26.34 Aligned_cols=13 Identities=38% Similarity=0.920 Sum_probs=10.3
Q ss_pred CcccchhhhhcCC
Q 044928 46 NREHWFFDAINNG 58 (321)
Q Consensus 46 kseqWFVDALNsv 58 (321)
+|..||++|+=..
T Consensus 124 nSHrWfFnaf~~~ 136 (163)
T PF01644_consen 124 NSHRWFFNAFCRQ 136 (163)
T ss_pred chhhHHHHHHHhh
Confidence 5889999987554
No 10
>PHA02106 hypothetical protein
Probab=7.49 E-value=2.2e+02 Score=23.72 Aligned_cols=12 Identities=42% Similarity=0.722 Sum_probs=9.0
Q ss_pred CCceeEEEeecC
Q 044928 15 RSARLRLFLFTK 26 (321)
Q Consensus 15 kpaRLRLFLFP~ 26 (321)
|--|||||+-..
T Consensus 59 klnrlrlfivsi 70 (91)
T PHA02106 59 KLNRLRLFVVSI 70 (91)
T ss_pred ccceEEEEEEEE
Confidence 456999998753
Done!