BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 044951
(375 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1V5S|A Chain A, Solution Structure Of Kinase Associated Domain 1 Of
Mouse MapMICROTUBULE AFFINITY-Regulating Kinase 3
Length = 126
Score = 29.6 bits (65), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 15/51 (29%), Positives = 25/51 (49%)
Query: 7 DVVIHGDSEEAAASSPNRKVTVSETRNIQNQGYTGLTDRLFRGSRAAVGGN 57
D +IH +E A + N+ + T N+ QG +G + + R R +G N
Sbjct: 3 DHLIHNVHKEEHAHAHNKDYDIPTTENLYFQGSSGSSGDMMREIRKVLGAN 53
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.136 0.404
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,333,393
Number of Sequences: 62578
Number of extensions: 326701
Number of successful extensions: 726
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 725
Number of HSP's gapped (non-prelim): 2
length of query: 375
length of database: 14,973,337
effective HSP length: 100
effective length of query: 275
effective length of database: 8,715,537
effective search space: 2396772675
effective search space used: 2396772675
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)