BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044963
         (104 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens GN=HSPA4L PE=1 SV=3
          Length = 839

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 25/57 (43%)

Query: 43  WIVLLMKFKKEKRKMFQVPYDAYTYSQNFDQGFAWDEPDSFSRSFSVRFADPNRIFL 99
           + VL+  F K K K+    +D Y   +NFD+       D F   + +   + +R  L
Sbjct: 208 YQVLVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKINVKENSRALL 264


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.322    0.137    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,356,252
Number of Sequences: 539616
Number of extensions: 1475996
Number of successful extensions: 2983
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2979
Number of HSP's gapped (non-prelim): 5
length of query: 104
length of database: 191,569,459
effective HSP length: 73
effective length of query: 31
effective length of database: 152,177,491
effective search space: 4717502221
effective search space used: 4717502221
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)