BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 044978
         (142 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2G9H|D Chain D, Crystal Structure Of Staphylococcal Enterotoxin I (Sei) In
           Complex With A Human Mhc Class Ii Molecule
          Length = 218

 Score = 26.2 bits (56), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 40  NKGHFVVYTTDEKRFSVPLECLSNNVVIELLRMSEE 75
           NKG  + +  DEK FS  L    + V +  L++ E+
Sbjct: 162 NKGKVLFHLNDEKSFSYDLFYTGDGVPVSFLKIYED 197


>pdb|1DJ2|A Chain A, Structures Of Adenylosuccinate Synthetase From Triticum
           Aestivum And Arabidopsis Thaliana
 pdb|1DJ2|B Chain B, Structures Of Adenylosuccinate Synthetase From Triticum
           Aestivum And Arabidopsis Thaliana
          Length = 443

 Score = 26.2 bits (56), Expect = 6.2,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 12/56 (21%)

Query: 39  ANKGHFVVYTTDEKRFSVPL----------EC-LSNNVVIELLRMSEEEFGLPSNG 83
           AN GH  +Y ++ K+F++ L           C + N VV+ L  + +E  GL SNG
Sbjct: 55  ANAGH-TIYNSEGKKFALHLVPSGILNEDTTCVIGNGVVVHLPGLFKEIDGLESNG 109


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.132    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,199,190
Number of Sequences: 62578
Number of extensions: 104627
Number of successful extensions: 186
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 185
Number of HSP's gapped (non-prelim): 2
length of query: 142
length of database: 14,973,337
effective HSP length: 89
effective length of query: 53
effective length of database: 9,403,895
effective search space: 498406435
effective search space used: 498406435
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 46 (22.3 bits)