Citrus Sinensis ID: 045019

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25

MSTSARAQASHDPNPNLHKPEPKESVNLFSTVNVPPDPLLDSGFFIDAAPPATSGSNTTTTNDQTSKKRGTIREHKSENLATTNGTESALTPETASTRRLTATEAWLPPGWEIEDRVRTSGATAGTVDKYYFHVASGRRFRSKKEVLYFLETGTKRKRRKENSNADMDSSGSAAGSTKQKKPNIKAKTSALNFDYFNSPENVEWVLTDPSEGSWTPFIGKVEVPESVRQDWAAAFTDLTTSNNGSKIC

ccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccEEEEEEEcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHccccccccc

*******************************************************************************************************EAWLPPGWEIEDRVRTSGATAGTVDKYYFHVASGRRFRSKKEVLYFLETGT***********************************ALNFDYFNSPENVEWVLTDPSEGSWTPFIGKVEVPESVRQDWAAAFTDLTTS*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Methyl-CpG-binding domain-containing protein 6	Transcriptional regulator that binds CpG, CpNpN and CpNpG (N is A, T, or C) islands in promoters regardless the DNA methylation status. Plays probably a role in gene silencing. May associate with histone deacetylase proteins (HDAC). Required for nucleolar dominance that consist in the silencing of rRNA genes inherited from one progenitor in genetic hybrids. Recruited to rRNA genes in a DRM2-dependent manner.	probable	Q9LTJ1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KY8, chain A
Confidence level:very confident
Coverage over the Query: 101-164
View the alignment between query and template
View the model in PyMOL