Citrus Sinensis ID: 045072


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550------
MDELKPCTANSSPLTPLGFLERAATVYGDCPSIIYNNLIYTWSQTHRRCLQLASSLSSIGITRGHVVSVVAPNIPAMYEAHFAIPFTGAILNNINTRLDARTISVLLQHSESKLVLVDYQSRNLVVEAISLFPSDIKCPPLVLIADHTDHDNDNKSSQTVDSNFCCTYESLVTKGDPNFKWIRPQNEWDPMILNYTSGTTSSPKGVVHCHRGIFVMTVDSLIDWSIPKQPVYLWTLPMFHANGWSYPWGMAAVGGTNVCLRKFDAAVIYKMIRQHGVTHMCGAPVVLNMISNLPRSEPLRNPVHILTAGAPPPAAVLFRTESLGFLVSHGYGLTETAGLVVSCAWKNKWNRLPATERARMKSRQGVRTVCFTEIDVIDSESGLSVSHDGASLGEIVFRGGSMMLGYLKDPNGTRKCMKDDGWFYTGDVGVIHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVARPDEFWGETPCAFLSLKAELEKKPTEKEIIEYCRARLPRYMVPKTVVFKEELPKTSTGKIKKFELREMAKAMGKSKVSRM
cccccccccccccccHHHHHHHHHHHcccccEEEEccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHccccccHHcccccccHHHHHHHHHccccEEEEEccccHHHHHHHHHccccccccccEEEEEccccccccccccccccccccccHHHHHccccccccccccccccccHHcccccccccccccEEEccHHHHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHHHcccEEccccccHHHHHHHHHHccccEEccHHHHHHHHHcccccccccccEEEEECccccHHHHHHHHHHcccEEEEECccccccccccccccccccccccHHHHHHHHccccccccccccEEEEccccccccccccccEEEEEEEEccccccccccccccccccccccccccccEEEEcccccEEEEcccccEEEcccccccHHHHHHHHcccccccEEEEEEcccccccccEEEEEEEcccccccccHHHHHHHHHccccccccccEEEEcccccccccccccHHHHHHHHHHccccccccc
****KPCTANSSPLTPLGFLERAATVYGDCPSIIYNNLIYTWSQTHRRCLQLASSLSSIGITRGHVVSVVAPNIPAMYEAHFAIPFTGAILNNINTRLDARTISVLLQHSESKLVLVDYQSRNLVVEAISLFPSDIKCPPLVLIADHTDHDN*******VDSNFCCTYESLVTKGDPNFKWIRPQNEWDPMILNYTSGTTSSPKGVVHCHRGIFVMTVDSLIDWSIPKQPVYLWTLPMFHANGWSYPWGMAAVGGTNVCLRKFDAAVIYKMIRQHGVTHMCGAPVVLNMISNLPRSEPLRNPVHILTAGAPPPAAVLFRTESLGFLVSHGYGLTETAGLVVSCAWKNKWNRLPATERARMKSRQGVRTVCFTEIDVIDSESGLSVSHDGASLGEIVFRGGSMMLGYLKDPNGTRKCMKDDGWFYTGDVGVIHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVARPDEFWGETPCAFLSLKAELEKKPTEKEIIEYCRARLPRYMVPKTVVFKEELPKTSTGKIKKFELREMAKA*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDELKPCTANSSPLTPLGFLERAATVYGDCPSIIYNNLIYTWSQTHRRCLQLASSLSSIGITRGHVVSVVAPNIPAMYEAHFAIPFTGAILNNINTRLDARTISVLLQHSESKLVLVDYQSRNLVVEAISLFPSDIKCPPLVLIADHTDHDNDNKSSQTVDSNFCCTYESLVTKGDPNFKWIRPQNEWDPMILNYTSGTTSSPKGVVHCHRGIFVMTVDSLIDWSIPKQPVYLWTLPMFHANGWSYPWGMAAVGGTNVCLRKFDAAVIYKMIRQHGVTHMCGAPVVLNMISNLPRSEPLRNPVHILTAGAPPPAAVLFRTESLGFLVSHGYGLTETAGLVVSCAWKNKWNRLPATERARMKSRQGVRTVCFTEIDVIDSESGLSVSHDGASLGEIVFRGGSMMLGYLKDPNGTRKCMKDDGWFYTGDVGVIHADGYLEIKDRSKDVIISGGENLSSVEVESVLYTNPAVNEAAVVARPDEFWGETPCAFLSLKAELEKKPTEKEIIEYCRARLPRYMVPKTVVFKEELPKTSTGKIKKFELREMAKAMGKSKVSRM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable acyl-activating enzyme 5, peroxisomal May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.confidentQ9FFE6
Long-chain-fatty-acid--CoA ligase FadD13 Required for maintaining the appropriate mycolic acid composition and permeability of the envelope on its exposure to acidic pH. Catalyzes the activation of long-chain fatty acids as acyl-coenzyme A (acyl-CoA), which are then transferred to the multifunctional polyketide synthase (PKS) type III for further chain extension. It has preference for the fatty acid with long chain length in the following order: hexacosanoic acid (C26), tetracosanoic acid (C24) and palmitic acid (C16).probableO53306
Long-chain-fatty-acid--CoA ligase Catalyzes the esterification of a number of long chain fatty acids with CoA, resulting in the formation of long-chain fatty acyl-CoA. Myristate (C14) is the most efficiently processed fatty acid, followed by palmitate (C16). Also catalyzes the esterification of stearate (C18) and laurate (C12), but at lower efficiency. Does not catalyze the esterification of the unsaturated fatty acids mysteroleic and palmitoleic acids in vitro.probableQ5SKN9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RY2, chain A
Confidence level:very confident
Coverage over the Query: 14-546
View the alignment between query and template
View the model in PyMOL
Template: 3T5A, chain A
Confidence level:very confident
Coverage over the Query: 14-148,173-441
View the alignment between query and template
View the model in PyMOL