BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 045130
(371 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q8VCP9|CLC14_MOUSE C-type lectin domain family 14 member A OS=Mus musculus GN=Clec14a
PE=2 SV=2
Length = 459
Score = 33.9 bits (76), Expect = 1.9, Method: Compositional matrix adjust.
Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
Query: 257 GNVVVGYWPGSLF---GYLSHSATIVEWGGQVYSPNVKKTPHTK 297
G V WPG ++ G + I++WG Q P ++KTP TK
Sbjct: 313 GAVTNRTWPGQVYDKPGEMPQVTEILQWGTQSTLPTIQKTPQTK 356
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.316 0.136 0.430
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 157,329,502
Number of Sequences: 539616
Number of extensions: 7210090
Number of successful extensions: 14031
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 14022
Number of HSP's gapped (non-prelim): 13
length of query: 371
length of database: 191,569,459
effective HSP length: 119
effective length of query: 252
effective length of database: 127,355,155
effective search space: 32093499060
effective search space used: 32093499060
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)