Query         045131
Match_columns 107
No_of_seqs    103 out of 128
Neff          5.1 
Searched_HMMs 46136
Date          Fri Mar 29 10:09:35 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045131.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045131hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01190 Pollen_Ole_e_I:  Polle  99.7 9.2E-17   2E-21  108.4   8.1   57    1-58     24-87  (97)
  2 PF09103 BRCA-2_OB1:  BRCA2, ol  81.9    0.54 1.2E-05   33.3   0.5   60   26-91     41-116 (118)
  3 cd04493 BRCA2DBD_OB1 BRCA2DBD_  79.5     3.3 7.1E-05   28.9   3.7   55   26-87     29-100 (100)
  4 PF13715 DUF4480:  Domain of un  75.6     2.7 5.8E-05   26.6   2.3   17   19-35     27-43  (88)
  5 PF05738 Cna_B:  Cna protein B-  74.2       8 0.00017   23.4   4.1   44    1-51      4-49  (70)
  6 PF10670 DUF4198:  Domain of un  73.8       6 0.00013   28.7   4.0   37    1-37    167-203 (215)
  7 PF13620 CarboxypepD_reg:  Carb  68.7     4.7  0.0001   24.9   2.2   18   18-35     29-47  (82)
  8 PF01060 DUF290:  Transthyretin  62.8     7.6 0.00017   25.0   2.4   19   17-35     29-47  (80)
  9 PF08400 phage_tail_N:  Prophag  62.5      11 0.00023   27.5   3.3   23   15-37     35-58  (134)
 10 smart00557 IG_FLMN Filamin-typ  62.4      28 0.00061   22.6   5.1   30    3-34     46-75  (93)
 11 PF00630 Filamin:  Filamin/ABP2  62.1      25 0.00055   22.4   4.8   30    3-34     60-89  (101)
 12 TIGR02513 type_III_yscB type I  60.9     8.8 0.00019   28.3   2.6   31   21-51     16-49  (139)
 13 COG4850 Uncharacterized conser  58.0      34 0.00075   28.9   5.9   45    3-51     99-145 (373)
 14 PRK13865 type IV secretion sys  54.7     6.2 0.00013   30.8   1.0   24   64-88    195-218 (229)
 15 PF11974 MG1:  Alpha-2-macroglo  51.4      23 0.00051   23.7   3.3   17   18-34     44-60  (97)
 16 PF12565 DUF3747:  Protein of u  51.2      26 0.00055   26.9   3.8   46   22-76     92-147 (181)
 17 PF08884 Flagellin_D3:  Flagell  49.0      34 0.00075   23.3   3.9   26   12-37     36-64  (90)
 18 KOG1948 Metalloproteinase-rela  46.7      14 0.00029   35.0   2.0   29    2-32    923-951 (1165)
 19 PRK13836 conjugal transfer pro  45.6     8.9 0.00019   29.2   0.6   26   63-89    186-211 (220)
 20 PF10875 DUF2670:  Protein of u  44.0     7.1 0.00015   28.6  -0.1   11   79-89      8-18  (139)
 21 PRK13872 conjugal transfer pro  41.5      12 0.00025   28.7   0.7   26   63-89    192-217 (228)
 22 TIGR02962 hdxy_isourate hydrox  40.9      81  0.0017   22.0   4.8   29    2-32     20-48  (112)
 23 PF03983 SHD1:  SLA1 homology d  33.6      22 0.00048   23.2   1.0   13   21-33     14-26  (70)
 24 PRK13887 conjugal transfer pro  31.2      14  0.0003   28.7  -0.3   12   78-89    230-241 (250)
 25 PF14686 fn3_3:  Polysaccharide  31.1      29 0.00064   23.4   1.3   12   21-32     44-55  (95)
 26 PHA02123 hypothetical protein   30.7      59  0.0013   23.6   2.8   57   20-82     40-110 (146)
 27 PF13115 YtkA:  YtkA-like        29.6 1.4E+02  0.0031   18.5   4.3   34    1-34     38-74  (86)
 28 KOG0518 Actin-binding cytoskel  29.4      65  0.0014   30.9   3.5   31    2-34    800-830 (1113)
 29 PF12249 AftA_C:  Arabinofurano  29.3      18  0.0004   27.7   0.0   13   78-90     75-87  (178)
 30 PF04335 VirB8:  VirB8 protein;  28.6      18 0.00038   26.3  -0.2   26   63-88    176-203 (212)
 31 cd03858 M14_CP_N-E_like Carbox  28.6      67  0.0015   26.1   3.2   15   20-34    325-339 (374)
 32 PF14059 DUF4251:  Domain of un  27.4 1.2E+02  0.0025   21.5   3.9   32   23-54     88-120 (138)
 33 PF11224 DUF3023:  Protein of u  26.4      59  0.0013   22.9   2.2   23   19-41      3-26  (130)
 34 TIGR01646 vgr_GE Rhs element V  26.3      78  0.0017   26.4   3.3   28   20-47    362-395 (483)
 35 TIGR03361 VI_Rhs_Vgr type VI s  25.1      90  0.0019   26.3   3.4   28   21-48    374-407 (513)
 36 PF09904 HTH_43:  Winged helix-  24.8      43 0.00093   23.0   1.2   19   14-32     51-69  (90)
 37 PF07679 I-set:  Immunoglobulin  24.0      85  0.0019   19.0   2.4   22   24-45     66-88  (90)
 38 PF10709 DUF2511:  Protein of u  23.0      84  0.0018   21.3   2.4   20    2-24     17-36  (87)
 39 PF01835 A2M_N:  MG2 domain;  I  22.3 2.2E+02  0.0048   18.1   5.1   32    2-34     37-69  (99)
 40 cd05717 Ig1_Necl-1-3_like Firs  22.0 2.1E+02  0.0046   17.8   4.3   30   39-69     65-94  (95)
 41 PF10440 WIYLD:  Ubiquitin-bind  20.9      39 0.00085   21.8   0.4   23   82-104    18-40  (65)
 42 PF02369 Big_1:  Bacterial Ig-l  20.8      81  0.0018   20.9   1.9   19   20-38     61-79  (100)
 43 PF00576 Transthyretin:  HIUase  20.4 1.6E+02  0.0036   20.4   3.5   28    2-30     20-47  (112)
 44 COG2885 OmpA Outer membrane pr  20.3      63  0.0014   23.5   1.4   20   14-33    114-135 (190)
 45 PF11589 DUF3244:  Domain of un  20.2   2E+02  0.0043   19.1   3.8   34    2-36     49-82  (106)
 46 PF04151 PPC:  Bacterial pre-pe  20.1      81  0.0017   19.2   1.7   13   23-35     58-70  (70)

No 1  
>PF01190 Pollen_Ole_e_I:  Pollen proteins Ole e I like;  InterPro: IPR006041 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Ole e 1. A number of plant pollen proteins, whose biological function is not yet known, are structurally related []. These proteins are most probably secreted and consist of about 145 residues. There are six cysteines which are conserved in the sequence of these proteins. They seem to be involved in disulphide bonds. 
Probab=99.70  E-value=9.2e-17  Score=108.39  Aligned_cols=57  Identities=39%  Similarity=0.753  Sum_probs=53.1

Q ss_pred             CeEEEEeecCCCCceEEEEEEEcCCCeeEEEEecCC------Cc-ceeEEEEeeCCCccCccccc
Q 045131            1 ATVALECKESEGGEVVYSREVVSDQSGTYKIPIEGC------HA-KLCQVRLVKSPKPECSEIVA   58 (107)
Q Consensus         1 A~V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v~~d------h~-~~C~V~LvsSP~~~C~~~~~   58 (107)
                      |+|+|+|++. .+.+.++.+++||++|+|+|+++++      |. +.|.|+|++||++.|+.+++
T Consensus        24 A~V~v~C~~~-~~~~~~~~~~~Td~~G~F~i~l~~~~~~~~~~~~~~C~v~l~~sp~~~C~~~~~   87 (97)
T PF01190_consen   24 AKVSVECKDG-NGGVVFSAEAKTDENGYFSIELPSDPGSSSPHLSSSCRVKLVSSPDPSCNVPTN   87 (97)
T ss_pred             CEEEEECCCC-CCCcEEEEEEEeCCCCEEEEEecCccccccCCCCCCcEEEEeCCCcCcCCCCcC
Confidence            7999999995 5559999999999999999999986      67 99999999999999999998


No 2  
>PF09103 BRCA-2_OB1:  BRCA2, oligonucleotide/oligosaccharide-binding, domain 1;  InterPro: IPR015187 This domain assumes an OB fold, which consists of a highly curved five-stranded beta-sheet that closes on itself to form a beta-barrel. OB1 has a shallow groove formed by one face of the curved sheet and is demarcated by two loops, one between beta 1 and beta 2 and another between beta 4 and beta 5, which allows for weak single strand DNA binding. The domain also binds the 70-amino acid DSS1 (deleted in split-hand/split foot syndrome) protein, which was originally identified as one of three genes that map to a 1.5-Mb locus deleted in an inherited developmental malformation syndrome []. ; GO: 0000724 double-strand break repair via homologous recombination; PDB: 1IYJ_D 1MIU_A.
Probab=81.90  E-value=0.54  Score=33.28  Aligned_cols=60  Identities=28%  Similarity=0.470  Sum_probs=27.4

Q ss_pred             CeeEEEEecCC--------------C-c-ceeEEEEeeCCCccCcccccCCCceeeEEeecCCCCCCCceeeecCCCccc
Q 045131           26 SGTYKIPIEGC--------------H-A-KLCQVRLVKSPKPECSEIVADGLSSARIDLTPSVGSDPELIRYANDLGFMK   89 (107)
Q Consensus        26 ~G~y~i~v~~d--------------h-~-~~C~V~LvsSP~~~C~~~~~~~r~~a~V~Lt~nnGi~s~~~R~aN~lgF~~   89 (107)
                      +|||.|...-|              + . .+|-+.|+.++++ |+..+.  .+...+.| ..|++.  ..|..-+|||.+
T Consensus        41 DGWY~Ika~lD~~L~~~l~~gki~vG~KL~v~GA~L~~~~~~-~~pLE~--~~~~~L~l-~~Nstr--~a~w~~kLG~~~  114 (118)
T PF09103_consen   41 DGWYSIKAQLDPPLTRLLRKGKIRVGQKLRVCGAELLGSKEP-CSPLEA--PDSVMLKL-HANSTR--PARWDAKLGFQK  114 (118)
T ss_dssp             -SS-EEEE---HHHHHHHHTT-S-TT-EEEESSBEEES--S----CCC----SS-EEE---CCCEE--EB-SSS-SEE-S
T ss_pred             cCCEEEEEEeCHHHHHHHHhCCccCCccEEEECceecCCCCC-cCCCcC--CCceEEEE-EeeeEE--eccccccCCCCC
Confidence            59999986533              2 3 8899999987644 776653  22343444 445653  356666999998


Q ss_pred             cC
Q 045131           90 KE   91 (107)
Q Consensus        90 ~~   91 (107)
                      +.
T Consensus       115 ~~  116 (118)
T PF09103_consen  115 DP  116 (118)
T ss_dssp             --
T ss_pred             CC
Confidence            74


No 3  
>cd04493 BRCA2DBD_OB1 BRCA2DBD_OB1: A subfamily of OB folds corresponding to the first OB fold (OB1) of the 800-amino acid C-terminal ssDNA binding domain (DBD) of BRCA2 (breast cancer susceptibility gene 2) protein, called BRCA2DBD. BRCA2 participates in homologous recombination-mediated repair of double-strand DNA breaks. It stimulates the displacement of Replication protein A (RPA), the most abundant eukaryotic ssDNA binding protein. It also facilitates filament formation. Mutations that map throughout the BRCA2 protein are associated with breast cancer susceptibility. BRCA2 is a large nuclear protein and its most conserved region is the C-terminal BRCA2DBD. BRCA2DBD binds ssDNA in vitro, and is composed of five structural domains, three of which are OB folds (OB1, OB2, and OB3). BRCA2DBD OB2 and OB3 are arranged in tandem, and their mode of binding can be considered qualitatively similar to two OB folds of RPA1, DBD-A and DBD-B (the major DBDs of RPA). BRCA2DBD OB1 binds DNA weakly.
Probab=79.48  E-value=3.3  Score=28.87  Aligned_cols=55  Identities=27%  Similarity=0.511  Sum_probs=37.8

Q ss_pred             CeeEEEEecCC---------------Cc-ceeEEEEeeCCCccCcccccCCCceeeEEee-cCCCCCCCceeeecCCCc
Q 045131           26 SGTYKIPIEGC---------------HA-KLCQVRLVKSPKPECSEIVADGLSSARIDLT-PSVGSDPELIRYANDLGF   87 (107)
Q Consensus        26 ~G~y~i~v~~d---------------h~-~~C~V~LvsSP~~~C~~~~~~~r~~a~V~Lt-~nnGi~s~~~R~aN~lgF   87 (107)
                      +|||.|...-|               +. -+|-+.|+.++++ |+..+. .   ..|.|. +-|++.  ..|..-+|||
T Consensus        29 DGWYsi~a~lD~~L~~~l~~gkl~vGqKL~i~GA~l~~~~~~-~sple~-~---~~~~L~l~~Nstr--~a~w~~~LGf  100 (100)
T cd04493          29 DGWYSIRAQLDPPLTNLVRKGKLRVGQKLRICGAELLGSANP-CSPLEA-P---DSVRLKINANSTR--RARWDARLGF  100 (100)
T ss_pred             cCeEEEEEEeCHHHHHHHHcCCeecccEEEEECceeecCCCC-cCcccC-C---CcEEEEEEcccee--ccccccccCC
Confidence            59999986533               33 7899999999755 877765 2   345553 446653  3677778887


No 4  
>PF13715 DUF4480:  Domain of unknown function (DUF4480)
Probab=75.59  E-value=2.7  Score=26.63  Aligned_cols=17  Identities=24%  Similarity=0.601  Sum_probs=14.1

Q ss_pred             EEEEcCCCeeEEEEecC
Q 045131           19 REVVSDQSGTYKIPIEG   35 (107)
Q Consensus        19 ~e~~TD~~G~y~i~v~~   35 (107)
                      ....||++|.|.|.++.
T Consensus        27 ~~~~Td~~G~F~i~~~~   43 (88)
T PF13715_consen   27 KGTVTDENGRFSIKLPE   43 (88)
T ss_pred             ceEEECCCeEEEEEEcC
Confidence            34679999999999873


No 5  
>PF05738 Cna_B:  Cna protein B-type domain;  InterPro: IPR008454 This entry represents a repeated B region domain found in the collagen-binding surface protein Cna in Staphylococcus aureus, as well as other related domains. The B region domain of Cna has a prealbumin-like beta-sandwich fold of seven strands in two sheets with a Greek key topology []. However, this domain does not mediate collagen binding, the IPR008456 from INTERPRO region carries out that function; instead it appears to form a stalk that presents the ligand binding domain away from the bacterial cell surface. Cna is a collagen-binding MSCRAMM (Microbial Surface Component Recognizing Adhesive Matrix Molecules), and is necessary and sufficient for S. aureus cells to adhere to cartilage.; PDB: 2X5P_A 3RKP_A 3KPT_A 1VLF_T 1TI2_F 1TI6_D 1TI4_J 1VLE_V 1VLD_X 3PF2_A ....
Probab=74.15  E-value=8  Score=23.45  Aligned_cols=44  Identities=27%  Similarity=0.408  Sum_probs=25.2

Q ss_pred             CeEEEEeecCCCCceEEEEEEEcCCCeeEEEEe--cCCCcceeEEEEeeCCCc
Q 045131            1 ATVALECKESEGGEVVYSREVVSDQSGTYKIPI--EGCHAKLCQVRLVKSPKP   51 (107)
Q Consensus         1 A~V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v--~~dh~~~C~V~LvsSP~~   51 (107)
                      |++.|.-.+   +......+.+||++|.|.+.-  +|..    .++-+++|..
T Consensus         4 a~f~L~~~~---~~~~~~~~~~Td~~G~~~f~~L~~G~Y----~l~E~~aP~G   49 (70)
T PF05738_consen    4 ATFELYDED---GNEVIEVTVTTDENGKYTFKNLPPGTY----TLKETKAPDG   49 (70)
T ss_dssp             EEEEEEETT---SEEEEEEEEEGGTTSEEEEEEEESEEE----EEEEEETTTT
T ss_pred             eEEEEEECC---CCEEEEEEEEECCCCEEEEeecCCeEE----EEEEEECCCC
Confidence            345554433   444443478999999999872  2332    4444555543


No 6  
>PF10670 DUF4198:  Domain of unknown function (DUF4198)
Probab=73.83  E-value=6  Score=28.66  Aligned_cols=37  Identities=11%  Similarity=-0.034  Sum_probs=24.6

Q ss_pred             CeEEEEeecCCCCceEEEEEEEcCCCeeEEEEecCCC
Q 045131            1 ATVALECKESEGGEVVYSREVVSDQSGTYKIPIEGCH   37 (107)
Q Consensus         1 A~V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v~~dh   37 (107)
                      |.|.+.-.+..........+.+||++|.+.|.++...
T Consensus       167 a~V~~~~~~~~~~~~~~~~~~~TD~~G~~~~~~~~~G  203 (215)
T PF10670_consen  167 AEVEAFSPGGWYDVEHEAKTLKTDANGRATFTLPRPG  203 (215)
T ss_pred             EEEEEEECCCccccccceEEEEECCCCEEEEecCCCE
Confidence            3566666653222222377889999999999987653


No 7  
>PF13620 CarboxypepD_reg:  Carboxypeptidase regulatory-like domain; PDB: 3MN8_D 3P0D_I 3KCP_A 2B59_B 1UWY_A 1H8L_A 1QMU_A 2NSM_A.
Probab=68.67  E-value=4.7  Score=24.93  Aligned_cols=18  Identities=11%  Similarity=0.313  Sum_probs=12.3

Q ss_pred             EEEEEcCCCeeEEEE-ecC
Q 045131           18 SREVVSDQSGTYKIP-IEG   35 (107)
Q Consensus        18 ~~e~~TD~~G~y~i~-v~~   35 (107)
                      .....||++|.|.|. ++.
T Consensus        29 ~~~~~Td~~G~f~~~~l~~   47 (82)
T PF13620_consen   29 VYTTTTDSDGRFSFEGLPP   47 (82)
T ss_dssp             CCEEE--TTSEEEEEEE-S
T ss_pred             EEEEEECCCceEEEEccCC
Confidence            466899999999998 664


No 8  
>PF01060 DUF290:  Transthyretin-like family;  InterPro: IPR001534 This new apparently nematode-specific protein family has been called family 2 []. The proteins show weak similarity to transthyretin (formerly called prealbumin) which transports thyroid hormones. The specific function of this protein is unknown.; GO: 0005615 extracellular space
Probab=62.83  E-value=7.6  Score=25.03  Aligned_cols=19  Identities=16%  Similarity=0.310  Sum_probs=14.9

Q ss_pred             EEEEEEcCCCeeEEEEecC
Q 045131           17 YSREVVSDQSGTYKIPIEG   35 (107)
Q Consensus        17 ~~~e~~TD~~G~y~i~v~~   35 (107)
                      .-.+.+||++|.|.|.=..
T Consensus        29 ll~~~~Td~~G~F~l~G~~   47 (80)
T PF01060_consen   29 LLDETKTDSDGNFELSGST   47 (80)
T ss_pred             eeEEEEECCCceEEEEEEc
Confidence            3457899999999998543


No 9  
>PF08400 phage_tail_N:  Prophage tail fibre N-terminal;  InterPro: IPR013609 This entry represents the N terminus of phage 933W tail fibre protein. The characteristics of the protein distribution suggest prophage matches.
Probab=62.53  E-value=11  Score=27.55  Aligned_cols=23  Identities=30%  Similarity=0.491  Sum_probs=18.6

Q ss_pred             eEEEEEEEcCCCeeEEEEec-CCC
Q 045131           15 VVYSREVVSDQSGTYKIPIE-GCH   37 (107)
Q Consensus        15 v~~~~e~~TD~~G~y~i~v~-~dh   37 (107)
                      +.+.....||++|.|.|++. |.+
T Consensus        35 ~~t~as~~t~~~G~Ys~~~epG~Y   58 (134)
T PF08400_consen   35 VGTVASVVTGEAGEYSFDVEPGVY   58 (134)
T ss_pred             EEEEEEEEcCCCceEEEEecCCeE
Confidence            35677889999999999987 554


No 10 
>smart00557 IG_FLMN Filamin-type immunoglobulin domains. These form a rod-like structure in the actin-binding cytoskeleton protein, filamin. The C-terminal repeats of filamin bind beta1-integrin (CD29).
Probab=62.42  E-value=28  Score=22.59  Aligned_cols=30  Identities=23%  Similarity=0.586  Sum_probs=18.2

Q ss_pred             EEEEeecCCCCceEEEEEEEcCCCeeEEEEec
Q 045131            3 VALECKESEGGEVVYSREVVSDQSGTYKIPIE   34 (107)
Q Consensus         3 V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v~   34 (107)
                      +.++.++...|  +|.+.-+-.+.|.|.|.|.
T Consensus        46 ~~~~v~d~~dG--ty~v~y~P~~~G~~~i~V~   75 (93)
T smart00557       46 VPVEVKDNGDG--TYTVSYTPTEPGDYTVTVK   75 (93)
T ss_pred             eEeEEEeCCCC--EEEEEEEeCCCEeEEEEEE
Confidence            34445554444  5666666777777777655


No 11 
>PF00630 Filamin:  Filamin/ABP280 repeat;  InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod. Whereas their actin-binding domains consist of two calponin homology domains (see IPR001715 from INTERPRO), their rods fall into three families. The rod domain of the family including the Dictyostelium discoideum (Slime mould) gelation factor (ABP120) and human filamin (ABP280) is constructed from tandem repeats of a 100-residue motif that is glycine and proline rich []. The gelation factor's rod contains 6 copies of the repeat, whereas filamin has a rod constructed from 24 repeats. The resolution of the 3D structure of rod repeats from the gelation factor has shown that they consist of a beta-sandwich, formed by two beta-sheets arranged in an immunoglobulin-like fold [, ]. Because conserved residues that form the core of the repeats are preserved in filamin, the repeat structure should be common to the members of the gelation factor/filamin family. The head to tail homodimerisation is crucial to the function of the ABP120 and ABP280 proteins. This interaction involves a small portion at the distal end of the rod domains. For the gelation factor it has been shown that the carboxy-terminal repeat 6 dimerises through a double edge-to-edge extension of the beta-sheet and that repeat 5 contributes to dimerisation to some extent [, , ].; PDB: 2DI9_A 2EEC_A 2DIC_A 2EEA_A 2DMC_A 2EE9_A 2D7O_A 2D7N_A 2K7P_A 2NQC_A ....
Probab=62.10  E-value=25  Score=22.40  Aligned_cols=30  Identities=27%  Similarity=0.576  Sum_probs=17.9

Q ss_pred             EEEEeecCCCCceEEEEEEEcCCCeeEEEEec
Q 045131            3 VALECKESEGGEVVYSREVVSDQSGTYKIPIE   34 (107)
Q Consensus         3 V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v~   34 (107)
                      +.++..+.+.|  +|.+.-+--..|.|+|.|.
T Consensus        60 ~~~~v~~~~~G--~y~v~y~p~~~G~y~i~V~   89 (101)
T PF00630_consen   60 VPVEVIDNGDG--TYTVSYTPTEPGKYKISVK   89 (101)
T ss_dssp             EEEEEEEESSS--EEEEEEEESSSEEEEEEEE
T ss_pred             cceEEEECCCC--EEEEEEEeCccEeEEEEEE
Confidence            34444554444  6666666667777777665


No 12 
>TIGR02513 type_III_yscB type III secretion system chaperone, YscB family. Members of this family include YscB of Yersinia and functionally equivalent (but differently named) proteins from type III secretion systems of other pathogens that affect animal cells. YscB acts, along with SycN (TIGR02503), as a chaperone for YopN, a key part of a complex that regulates type III secretion so it responds to contact with the eukaryotic target cell.
Probab=60.86  E-value=8.8  Score=28.33  Aligned_cols=31  Identities=19%  Similarity=0.392  Sum_probs=22.1

Q ss_pred             EEcCCCeeEEEEecCCCc---ceeEEEEeeCCCc
Q 045131           21 VVSDQSGTYKIPIEGCHA---KLCQVRLVKSPKP   51 (107)
Q Consensus        21 ~~TD~~G~y~i~v~~dh~---~~C~V~LvsSP~~   51 (107)
                      .+-|++|.|.|+|++.--   +-=.-.|.+||.+
T Consensus        16 FVAd~qG~Yhl~iD~~~l~l~q~~sellletpL~   49 (139)
T TIGR02513        16 FVADRQGVYHLTIDQHLVMLAQHGSELVLETPLD   49 (139)
T ss_pred             cccCCCCceEEEEcCcEEEeeccCceEEEecccc
Confidence            358999999999998742   2334456777764


No 13 
>COG4850 Uncharacterized conserved protein [Function unknown]
Probab=58.03  E-value=34  Score=28.90  Aligned_cols=45  Identities=18%  Similarity=0.124  Sum_probs=33.2

Q ss_pred             EEEEeecCCCCceEEEEEEEcCCCeeEEEEecCCCc--ceeEEEEeeCCCc
Q 045131            3 VALECKESEGGEVVYSREVVSDQSGTYKIPIEGCHA--KLCQVRLVKSPKP   51 (107)
Q Consensus         3 V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v~~dh~--~~C~V~LvsSP~~   51 (107)
                      |.|.|... .++   ++-+.||.+|+|-|...-+|.  ..=+.+.+.++..
T Consensus        99 vpV~~T~~-~~~---tv~~~Td~~Gyf~i~~~~~~~~~~g~~av~lq~eg~  145 (373)
T COG4850          99 VPVYVTLK-NGA---TVNVATDDEGYFIIHAVIPFPPTKGNHAVRLQSEGE  145 (373)
T ss_pred             ceEEEecC-CCc---eEEeEecCCCceEEEEecccCCCCCceeEEeecCCC
Confidence            66777773 333   334589999999999888886  6667778888764


No 14 
>PRK13865 type IV secretion system protein VirB8; Provisional
Probab=54.66  E-value=6.2  Score=30.79  Aligned_cols=24  Identities=17%  Similarity=0.210  Sum_probs=14.8

Q ss_pred             eeEEeecCCCCCCCceeeecCCCcc
Q 045131           64 ARIDLTPSVGSDPELIRYANDLGFM   88 (107)
Q Consensus        64 a~V~Lt~nnGi~s~~~R~aN~lgF~   88 (107)
                      |.|......-+.. ..|..|||||.
T Consensus       195 ATv~y~~~~~~~e-~~R~~NPLGF~  218 (229)
T PRK13865        195 ATVRYEKVTSLPG-RLRLTNPGGLI  218 (229)
T ss_pred             EEEEEccCCCCCH-HHHhcCCCCcE
Confidence            4444442222444 57999999996


No 15 
>PF11974 MG1:  Alpha-2-macroglobulin MG1 domain;  InterPro: IPR021868  This is the N-terminal MG1 domain from alpha-2-macroglobulin []. 
Probab=51.40  E-value=23  Score=23.72  Aligned_cols=17  Identities=12%  Similarity=-0.003  Sum_probs=14.7

Q ss_pred             EEEEEcCCCeeEEEEec
Q 045131           18 SREVVSDQSGTYKIPIE   34 (107)
Q Consensus        18 ~~e~~TD~~G~y~i~v~   34 (107)
                      -.+++||++|...+...
T Consensus        44 l~~g~TD~~G~a~~~~~   60 (97)
T PF11974_consen   44 LASGKTDADGFASFDST   60 (97)
T ss_pred             eeeeeeCCCceEEecCC
Confidence            36889999999999877


No 16 
>PF12565 DUF3747:  Protein of unknown function (DUF3747);  InterPro: IPR022222  This family of proteins is found in bacteria. Proteins in this family are typically between 215 and 413 amino acids in length. There is a conserved DSNGYS sequence motif. 
Probab=51.22  E-value=26  Score=26.93  Aligned_cols=46  Identities=24%  Similarity=0.386  Sum_probs=28.6

Q ss_pred             EcCCCeeEEEEecCCC---------c-ceeEEEEeeCCCccCcccccCCCceeeEEeecCCCCCC
Q 045131           22 VSDQSGTYKIPIEGCH---------A-KLCQVRLVKSPKPECSEIVADGLSSARIDLTPSVGSDP   76 (107)
Q Consensus        22 ~TD~~G~y~i~v~~dh---------~-~~C~V~LvsSP~~~C~~~~~~~r~~a~V~Lt~nnGi~s   76 (107)
                      .||+|| |.|-+.|+.         . ..=++.|+..|..        .+....|++-|-.|+++
T Consensus        92 ~tDSNG-YSlR~~G~Dlg~~YrLrlv~~~~el~L~a~~~~--------~~~~p~ivigrt~g~~~  147 (181)
T PF12565_consen   92 YTDSNG-YSLRIGGQDLGLRYRLRLVQRNGELVLVATPRR--------DPSAPEIVIGRTGGIAN  147 (181)
T ss_pred             ccCCCC-cEEEECCeecCceEEEEEEEECCEEEEEecCCC--------CCCcceEEEEecCCCcC
Confidence            489998 677777642         1 3346677765532        12234577878888865


No 17 
>PF08884 Flagellin_D3:  Flagellin D3 domain;  InterPro: IPR014981 This domain is found in the central portion bacterial flagellin FliC, it contains a structural motif called a beta-folium fold []. Although no specific function is assigned its deletion leads to a reduction in filament stability []. ; PDB: 1IO1_A 1UCU_A 3A5X_A.
Probab=49.03  E-value=34  Score=23.27  Aligned_cols=26  Identities=12%  Similarity=0.277  Sum_probs=15.1

Q ss_pred             CCceEEEEEEE--cCCCeeEEEEecC-CC
Q 045131           12 GGEVVYSREVV--SDQSGTYKIPIEG-CH   37 (107)
Q Consensus        12 ~~~v~~~~e~~--TD~~G~y~i~v~~-dh   37 (107)
                      +|+.--.+++.  +.++|+|.+.|+. +.
T Consensus        36 ~gkYYv~V~g~~~~~knG~Yev~Vd~~~G   64 (90)
T PF08884_consen   36 SGKYYVEVTGTTATAKNGYYEVTVDDTDG   64 (90)
T ss_dssp             T--EEEEEEEET-SS--EEEEEEE-TTT-
T ss_pred             CCCeEEEEEeeccCCCCccEEEEEecCCC
Confidence            45555556666  8999999999998 54


No 18 
>KOG1948 consensus Metalloproteinase-related collagenase pM5 [Posttranslational modification, protein turnover, chaperones]
Probab=46.73  E-value=14  Score=35.02  Aligned_cols=29  Identities=34%  Similarity=0.588  Sum_probs=22.4

Q ss_pred             eEEEEeecCCCCceEEEEEEEcCCCeeEEEE
Q 045131            2 TVALECKESEGGEVVYSREVVSDQSGTYKIP   32 (107)
Q Consensus         2 ~V~leCk~~~~~~v~~~~e~~TD~~G~y~i~   32 (107)
                      -|.+|-+.- +- --|.-|++||++|.|+|.
T Consensus       923 gVaieA~sd-n~-~~y~eeattdenG~yRiR  951 (1165)
T KOG1948|consen  923 GVAIEALSD-NC-DLYQEEATTDENGTYRIR  951 (1165)
T ss_pred             CeEEEEecC-CC-CccccccccccCCcEEEe
Confidence            366776663 22 678899999999999986


No 19 
>PRK13836 conjugal transfer protein TrbF; Provisional
Probab=45.58  E-value=8.9  Score=29.20  Aligned_cols=26  Identities=15%  Similarity=0.087  Sum_probs=16.5

Q ss_pred             eeeEEeecCCCCCCCceeeecCCCccc
Q 045131           63 SARIDLTPSVGSDPELIRYANDLGFMK   89 (107)
Q Consensus        63 ~a~V~Lt~nnGi~s~~~R~aN~lgF~~   89 (107)
                      ++-++++.+.=... ..|..|||||.=
T Consensus       186 ~~i~ti~~~~p~te-~~~~~NPLGf~V  211 (220)
T PRK13836        186 RGIATVTLTPPQDE-ATIRLNPIGLYL  211 (220)
T ss_pred             EEEEEEEEcCCCCH-HHHHhCCCeEEE
Confidence            34455554322344 689999999963


No 20 
>PF10875 DUF2670:  Protein of unknown function (DUF2670);  InterPro: IPR022714  This bacterial family of proteins has no known function and appears to be restricted to Rickettsiaceae. 
Probab=43.98  E-value=7.1  Score=28.57  Aligned_cols=11  Identities=36%  Similarity=0.594  Sum_probs=9.0

Q ss_pred             eeeecCCCccc
Q 045131           79 IRYANDLGFMK   89 (107)
Q Consensus        79 ~R~aN~lgF~~   89 (107)
                      +-+||||||+-
T Consensus         8 lIaaNPMg~fl   18 (139)
T PF10875_consen    8 LIAANPMGFFL   18 (139)
T ss_pred             HHhhCCchhhH
Confidence            45799999985


No 21 
>PRK13872 conjugal transfer protein TrbF; Provisional
Probab=41.46  E-value=12  Score=28.66  Aligned_cols=26  Identities=19%  Similarity=0.121  Sum_probs=17.1

Q ss_pred             eeeEEeecCCCCCCCceeeecCCCccc
Q 045131           63 SARIDLTPSVGSDPELIRYANDLGFMK   89 (107)
Q Consensus        63 ~a~V~Lt~nnGi~s~~~R~aN~lgF~~   89 (107)
                      .|.|......-... ..|..|||||.=
T Consensus       192 ~atvt~~~~~p~~e-~~~~~NPLGf~V  217 (228)
T PRK13872        192 TAILTIVIQPPRDA-ERLRKNPLGIYV  217 (228)
T ss_pred             EEEEEEEEcCCCCH-HHHhhCCCeEEE
Confidence            45565543333444 689999999963


No 22 
>TIGR02962 hdxy_isourate hydroxyisourate hydrolase. Members of this family, hydroxyisourate hydrolase, represent a distinct clade of transthyretin-related proteins. Bacterial members typically are encoded next to ureidoglycolate hydrolase and often near either xanthine dehydrogenase or xanthine/uracil permease genes and have been demonstrated to have hydroxyisourate hydrolase activity. In eukaryotes, a clade separate from the transthyretins (a family of thyroid-hormone binding proteins) has also been shown to have HIU hydrolase activity in urate catabolizing organisms. Transthyretin, then, would appear to be the recently diverged paralog of the more ancient HIUH family.
Probab=40.94  E-value=81  Score=22.01  Aligned_cols=29  Identities=17%  Similarity=0.015  Sum_probs=20.8

Q ss_pred             eEEEEeecCCCCceEEEEEEEcCCCeeEEEE
Q 045131            2 TVALECKESEGGEVVYSREVVSDQSGTYKIP   32 (107)
Q Consensus         2 ~V~leCk~~~~~~v~~~~e~~TD~~G~y~i~   32 (107)
                      .|+|...+ + +.-+.-.+++||++|..+-.
T Consensus        20 ~V~L~~~~-~-~~~~~i~~~~Tn~DGR~~~~   48 (112)
T TIGR02962        20 PVTLYRLD-G-SGWTPLAEGVTNADGRCPDL   48 (112)
T ss_pred             EEEEEEec-C-CCeEEEEEEEECCCCCCcCc
Confidence            68888765 2 33466679999999988743


No 23 
>PF03983 SHD1:  SLA1 homology domain 1, SHD1 ;  InterPro: IPR007131 The SLA1 homology domain is found in the cytoskeleton assembly control protein SLA1, which is responsible for the correct formation of the actin cytoskeleton.; GO: 0008092 cytoskeletal protein binding, 0030674 protein binding, bridging, 0042802 identical protein binding, 0043130 ubiquitin binding; PDB: 2HBP_A.
Probab=33.59  E-value=22  Score=23.23  Aligned_cols=13  Identities=23%  Similarity=0.601  Sum_probs=8.9

Q ss_pred             EEcCCCeeEEEEe
Q 045131           21 VVSDQSGTYKIPI   33 (107)
Q Consensus        21 ~~TD~~G~y~i~v   33 (107)
                      -.||.+|.|+|+-
T Consensus        14 tWtD~tG~f~VeA   26 (70)
T PF03983_consen   14 TWTDRTGKFKVEA   26 (70)
T ss_dssp             EEEBSSS--EEEE
T ss_pred             EEEeCCCCEEEEE
Confidence            4799999999873


No 24 
>PRK13887 conjugal transfer protein TrbF; Provisional
Probab=31.22  E-value=14  Score=28.74  Aligned_cols=12  Identities=8%  Similarity=-0.227  Sum_probs=10.4

Q ss_pred             ceeeecCCCccc
Q 045131           78 LIRYANDLGFMK   89 (107)
Q Consensus        78 ~~R~aN~lgF~~   89 (107)
                      ..|..|||||.=
T Consensus       230 ~~r~~NPLGf~V  241 (250)
T PRK13887        230 EQLRNNPHSIYV  241 (250)
T ss_pred             HHHhhCCCeEEE
Confidence            689999999963


No 25 
>PF14686 fn3_3:  Polysaccharide lyase family 4, domain II; PDB: 1NKG_A 2XHN_B 3NJX_A 3NJV_A.
Probab=31.09  E-value=29  Score=23.36  Aligned_cols=12  Identities=33%  Similarity=0.800  Sum_probs=6.9

Q ss_pred             EEcCCCeeEEEE
Q 045131           21 VVSDQSGTYKIP   32 (107)
Q Consensus        21 ~~TD~~G~y~i~   32 (107)
                      +.||++|.|.|+
T Consensus        44 t~td~~G~Fti~   55 (95)
T PF14686_consen   44 TRTDSDGNFTIP   55 (95)
T ss_dssp             EE--TTSEEE--
T ss_pred             EEeCCCCcEEeC
Confidence            468999999998


No 26 
>PHA02123 hypothetical protein
Probab=30.73  E-value=59  Score=23.63  Aligned_cols=57  Identities=18%  Similarity=0.287  Sum_probs=34.4

Q ss_pred             EEEcCCCeeEEEEec--CC----Cc-ceeE-------EEEeeCCCccCcccccCCCceeeEEeecCCCCCCCceeee
Q 045131           20 EVVSDQSGTYKIPIE--GC----HA-KLCQ-------VRLVKSPKPECSEIVADGLSSARIDLTPSVGSDPELIRYA   82 (107)
Q Consensus        20 e~~TD~~G~y~i~v~--~d----h~-~~C~-------V~LvsSP~~~C~~~~~~~r~~a~V~Lt~nnGi~s~~~R~a   82 (107)
                      ..-||++|.|.-.+.  -|    .+ +.|.       .+|+.|...+=++.+.  ..|-.|   .-|||.+ ++.|.
T Consensus        40 ~eftdeng~yesals~scd~~~~~~~d~clgiifnsdyw~id~ar~d~~il~~--servmi---s~~givq-nv~yi  110 (146)
T PHA02123         40 QEFTDENGTYESALSASCDREVREQYDNCLGIVFNSDYWLIDGARDDKNILVG--TERVMI---SLNGIVQ-NVDYI  110 (146)
T ss_pred             hhhhcCCCcEeehhcccccHHHHhhcCceEEEEecCceEEEecccCCCceeec--ceEEEE---EecceEe-eeEEE
Confidence            446999999984433  22    12 5664       5677777777666665  223333   3478877 66664


No 27 
>PF13115 YtkA:  YtkA-like
Probab=29.64  E-value=1.4e+02  Score=18.55  Aligned_cols=34  Identities=21%  Similarity=0.308  Sum_probs=17.8

Q ss_pred             CeEEEEeecCC--C-CceEEEEEEEcCCCeeEEEEec
Q 045131            1 ATVALECKESE--G-GEVVYSREVVSDQSGTYKIPIE   34 (107)
Q Consensus         1 A~V~leCk~~~--~-~~v~~~~e~~TD~~G~y~i~v~   34 (107)
                      |.|.|+...-.  . .......+....+.|.|.+++.
T Consensus        38 a~V~~~~~m~~~~g~~~~~~~~~~~~~~~G~Y~~~~~   74 (86)
T PF13115_consen   38 ADVQFEIWMPDMEGMEPMTSKVELEETGPGVYEAEVT   74 (86)
T ss_pred             CEEEEEEEeCCCCCCCCCceeeeeecCCCCeEEEEee
Confidence            45666665532  1 1224445555566777776654


No 28 
>KOG0518 consensus Actin-binding cytoskeleton protein, filamin [Cytoskeleton]
Probab=29.36  E-value=65  Score=30.91  Aligned_cols=31  Identities=29%  Similarity=0.478  Sum_probs=25.6

Q ss_pred             eEEEEeecCCCCceEEEEEEEcCCCeeEEEEec
Q 045131            2 TVALECKESEGGEVVYSREVVSDQSGTYKIPIE   34 (107)
Q Consensus         2 ~V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v~   34 (107)
                      ||-|.|.++..|  ++.+..+-++.|.|.|.++
T Consensus       800 kvd~~~~d~~dG--t~kV~ytPtepG~Y~I~i~  830 (1113)
T KOG0518|consen  800 KVDLNVEDREDG--TCKVSYTPTEPGTYIINIK  830 (1113)
T ss_pred             ccccceeecCCC--eEEEEEeCCCCceEEEEEE
Confidence            688999998777  5666666899999999876


No 29 
>PF12249 AftA_C:  Arabinofuranosyltransferase A C terminal;  InterPro: IPR020959 The arabinofuranosyltransferase enzyme AftA is involved in cell wall arabinan biosynthesis in bacteria []. It catalyses the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. As this enzyme is important for cell growth and is found in some important pathogens, such as Mycobacterium tuberculosis, it represents a potential target for the devlopment of new antibacterial drugs. This entry represents the C-terminal domain of AftA.; GO: 0016757 transferase activity, transferring glycosyl groups, 0044038 cell wall macromolecule biosynthetic process, 0005886 plasma membrane, 0016021 integral to membrane
Probab=29.32  E-value=18  Score=27.69  Aligned_cols=13  Identities=31%  Similarity=0.378  Sum_probs=10.1

Q ss_pred             ceeeecCCCcccc
Q 045131           78 LIRYANDLGFMKK   90 (107)
Q Consensus        78 ~~R~aN~lgF~~~   90 (107)
                      .-+||||||=+.+
T Consensus        75 TsHYANPLaeF~~   87 (178)
T PF12249_consen   75 TSHYANPLAEFDE   87 (178)
T ss_pred             chhhcCchhhHHH
Confidence            4589999996654


No 30 
>PF04335 VirB8:  VirB8 protein;  InterPro: IPR007430  VirB8 is a bacterial virulence protein with cytoplasmic, transmembrane, and periplasmic regions. It is thought that it is a primary constituent of a DNA transporter. The periplasmic region interacts with VirB9, VirB10, and itself []. This family also includes the conjugal transfer protein family TrbF, a family of proteins known to be involved in conjugal transfer. The TrbF protein is thought to compose part of the pilus required for transfer []. ; GO: 0016020 membrane; PDB: 2CC3_B 2BHM_C.
Probab=28.60  E-value=18  Score=26.33  Aligned_cols=26  Identities=27%  Similarity=0.217  Sum_probs=13.3

Q ss_pred             eeeEEeecC--CCCCCCceeeecCCCcc
Q 045131           63 SARIDLTPS--VGSDPELIRYANDLGFM   88 (107)
Q Consensus        63 ~a~V~Lt~n--nGi~s~~~R~aN~lgF~   88 (107)
                      ++.|.....  +-..+...|..|||||.
T Consensus       176 ~~~v~~~~~~~~~~~~~~~~~~NPlGf~  203 (212)
T PF04335_consen  176 RATVTYEYRPINPPMTEEDRLINPLGFY  203 (212)
T ss_dssp             EEEEEEEE--EGCGS-HHHHTT-TT-EE
T ss_pred             EEEEEEEecCCCCCCCHHHHhhCCCceE
Confidence            455555321  23223368999999996


No 31 
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. The N/E subfamily includes eight members, of which five (CPN, CPE, CPM, CPD, CPZ) are considered enzymatically active, while the other three are non-active (CPX1, PCX2, ACLP/AEBP1) and lack the critical active site and substrate-binding residues considered necessary for CP activity. These non-active members may function as binding proteins or display catalytic activity towards other substrates. Unlike the A/B CP subfamily, enzymes belonging to the N/E subfamily are not produced as inactive precursors that require proteolysis to produce the active form; rather, they rely on their substrate specificity and subcellular compartmentalization to prevent inappr
Probab=28.59  E-value=67  Score=26.12  Aligned_cols=15  Identities=20%  Similarity=0.350  Sum_probs=12.5

Q ss_pred             EEEcCCCeeEEEEec
Q 045131           20 EVVSDQSGTYKIPIE   34 (107)
Q Consensus        20 e~~TD~~G~y~i~v~   34 (107)
                      ...||.+|.|.+.++
T Consensus       325 ~~~Td~~G~f~~~l~  339 (374)
T cd03858         325 DVTTAEDGDYWRLLL  339 (374)
T ss_pred             eeEECCCceEEEecC
Confidence            467999999998775


No 32 
>PF14059 DUF4251:  Domain of unknown function (DUF4251); PDB: 3FYF_B.
Probab=27.36  E-value=1.2e+02  Score=21.53  Aligned_cols=32  Identities=16%  Similarity=0.266  Sum_probs=18.3

Q ss_pred             cCCCeeEEEEecCCCc-ceeEEEEeeCCCccCc
Q 045131           23 SDQSGTYKIPIEGCHA-KLCQVRLVKSPKPECS   54 (107)
Q Consensus        23 TD~~G~y~i~v~~dh~-~~C~V~LvsSP~~~C~   54 (107)
                      +|+.|...|...-.+. +...+.|-=.|...|+
T Consensus        88 ~~kKg~~~i~f~~~~~~~~~~~~i~i~~ng~a~  120 (138)
T PF14059_consen   88 TDKKGNWRISFSVRGKEDSYTFTITIFPNGSAS  120 (138)
T ss_dssp             E-TT--EEEEEEEE-SS-EEEEEEEE-TTSEEE
T ss_pred             eccCCCEEEEEEECCCceEEEEEEEEecCCEEE
Confidence            7999998888776666 7788888655544443


No 33 
>PF11224 DUF3023:  Protein of unknown function (DUF3023);  InterPro: IPR021387  This bacterial family of proteins with unknown function appear to be restricted to Alphaproteobacteria. 
Probab=26.44  E-value=59  Score=22.90  Aligned_cols=23  Identities=22%  Similarity=0.249  Sum_probs=18.9

Q ss_pred             EEEEcCCCeeEEEEecCCCc-cee
Q 045131           19 REVVSDQSGTYKIPIEGCHA-KLC   41 (107)
Q Consensus        19 ~e~~TD~~G~y~i~v~~dh~-~~C   41 (107)
                      --|.||.+|.-.|.+..+|. +.|
T Consensus         3 CIG~T~~~g~L~V~i~~~~~~~~~   26 (130)
T PF11224_consen    3 CIGNTDNNGKLNVHINKDHPKNLL   26 (130)
T ss_pred             EEeeeCCCCcEEEEECCCCcCCcc
Confidence            35789999999999999886 444


No 34 
>TIGR01646 vgr_GE Rhs element Vgr protein. This model represents the Vgr family of proteins, associated with some classes of Rhs elements. This model does not include a large octapeptide repeat region, VGXXXXXX, found in the Vgr of Rhs classes G and E.
Probab=26.32  E-value=78  Score=26.44  Aligned_cols=28  Identities=18%  Similarity=0.399  Sum_probs=22.2

Q ss_pred             EEEcCCCeeEEEEecCCC-----c-ceeEEEEee
Q 045131           20 EVVSDQSGTYKIPIEGCH-----A-KLCQVRLVK   47 (107)
Q Consensus        20 e~~TD~~G~y~i~v~~dh-----~-~~C~V~Lvs   47 (107)
                      |..||+.|.|+|.++-|.     . ..|++++.+
T Consensus       362 ~~~~d~~GRvkV~f~wd~~~~~~~~~S~W~Rvaq  395 (483)
T TIGR01646       362 EIHTDKYGRIRVHFHWDRYGQSNDYSSCWIRVAQ  395 (483)
T ss_pred             eeccCCCCcEEEEeecCCCCCCCCCCceEEEEec
Confidence            445999999999988543     2 689999877


No 35 
>TIGR03361 VI_Rhs_Vgr type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.
Probab=25.11  E-value=90  Score=26.30  Aligned_cols=28  Identities=21%  Similarity=0.393  Sum_probs=22.7

Q ss_pred             EEcCCCeeEEEEecCC----C-c-ceeEEEEeeC
Q 045131           21 VVSDQSGTYKIPIEGC----H-A-KLCQVRLVKS   48 (107)
Q Consensus        21 ~~TD~~G~y~i~v~~d----h-~-~~C~V~LvsS   48 (107)
                      ..||+.|.|+|.++-|    . + ..|+|++.+.
T Consensus       374 i~~D~~GRvkV~f~wd~~~~~~~~~S~wvRvaqp  407 (513)
T TIGR03361       374 IYTDEYGRVKVQFHWDRYGKRDEKSSCWVRVAQP  407 (513)
T ss_pred             EeECCCCCEEEEecccCCCCCCCCCceEEEeccc
Confidence            4599999999999854    2 4 8899999874


No 36 
>PF09904 HTH_43:  Winged helix-turn helix;  InterPro: IPR017162 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.; PDB: 3KE2_B.
Probab=24.84  E-value=43  Score=23.01  Aligned_cols=19  Identities=21%  Similarity=0.496  Sum_probs=11.9

Q ss_pred             ceEEEEEEEcCCCeeEEEE
Q 045131           14 EVVYSREVVSDQSGTYKIP   32 (107)
Q Consensus        14 ~v~~~~e~~TD~~G~y~i~   32 (107)
                      ++.|..+|.....|+|+|.
T Consensus        51 ~~~Fvq~G~R~~~GyY~i~   69 (90)
T PF09904_consen   51 ECEFVQDGERNNAGYYRIS   69 (90)
T ss_dssp             EEEEE--TTS-S--EEEEE
T ss_pred             EEEEEecCccCCCCcEEee
Confidence            5677888999999999997


No 37 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=23.99  E-value=85  Score=18.98  Aligned_cols=22  Identities=23%  Similarity=0.391  Sum_probs=13.0

Q ss_pred             CCCeeEEEEecCCCc-ceeEEEE
Q 045131           24 DQSGTYKIPIEGCHA-KLCQVRL   45 (107)
Q Consensus        24 D~~G~y~i~v~~dh~-~~C~V~L   45 (107)
                      +..|.|+..+...+. ..|.+.|
T Consensus        66 ~D~G~Y~C~~~n~~g~~~~~~~l   88 (90)
T PF07679_consen   66 EDAGTYTCVASNSSGEATASVNL   88 (90)
T ss_dssp             GGSEEEEEEEEETTEEEEEEEEE
T ss_pred             hhCEEEEEEEEECCCEEEEEEEE
Confidence            455666666666655 5555544


No 38 
>PF10709 DUF2511:  Protein of unknown function (DUF2511);  InterPro: IPR019648 This entry is represented by Bacteriophage PsP3, Gp28. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=23.03  E-value=84  Score=21.31  Aligned_cols=20  Identities=25%  Similarity=0.511  Sum_probs=14.3

Q ss_pred             eEEEEeecCCCCceEEEEEEEcC
Q 045131            2 TVALECKESEGGEVVYSREVVSD   24 (107)
Q Consensus         2 ~V~leCk~~~~~~v~~~~e~~TD   24 (107)
                      .|.|+|+.   +...|.+...|+
T Consensus        17 ev~l~C~~---~~alfv~n~~tl   36 (87)
T PF10709_consen   17 EVMLECRP---GNALFVINPSTL   36 (87)
T ss_pred             eEEEEEcC---CCEEEEEcCCCC
Confidence            58999987   566688665553


No 39 
>PF01835 A2M_N:  MG2 domain;  InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white. A2M-like proteins are able to inhibit all four classes of proteinases by a 'trapping' mechanism. They have a peptide stretch, called the 'bait region', which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein, thus trapping the proteinase. The entrapped enzyme remains active against low molecular weight substrates, whilst its activity toward larger substrates is greatly reduced, due to steric hindrance. Following cleavage in the bait region, a thiol ester bond, formed between the side chains of a cysteine and a glutamine, is cleaved and mediates the covalent binding of the A2M-like protein to the proteinase. This family includes the N-terminal region of the alpha-2-macroglobulin family. The inhibitor domains belong to MEROPS inhibitor family I39.; GO: 0004866 endopeptidase inhibitor activity; PDB: 2B39_B 3KLS_B 3PRX_C 3KM9_B 3PVM_C 3CU7_A 4E0S_A 4A5W_A 4ACQ_C 2P9R_B ....
Probab=22.29  E-value=2.2e+02  Score=18.09  Aligned_cols=32  Identities=19%  Similarity=0.444  Sum_probs=24.1

Q ss_pred             eEEEEeecCCCCceEEEEEE-EcCCCeeEEEEec
Q 045131            2 TVALECKESEGGEVVYSREV-VSDQSGTYKIPIE   34 (107)
Q Consensus         2 ~V~leCk~~~~~~v~~~~e~-~TD~~G~y~i~v~   34 (107)
                      .|.|+=+| -.|+..+.... .++..|.|...+.
T Consensus        37 ~~~v~i~d-p~g~~v~~~~~~~~~~~G~~~~~~~   69 (99)
T PF01835_consen   37 PVTVTIKD-PSGNEVFRWSVNTTNENGIFSGSFQ   69 (99)
T ss_dssp             EEEEEEEE-TTSEEEEEEEEEETTCTTEEEEEEE
T ss_pred             ceEEEEEC-CCCCEEEEEEeeeeCCCCEEEEEEE
Confidence            35566667 47888888888 8899998887654


No 40 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=22.04  E-value=2.1e+02  Score=17.84  Aligned_cols=30  Identities=20%  Similarity=0.318  Sum_probs=15.2

Q ss_pred             ceeEEEEeeCCCccCcccccCCCceeeEEee
Q 045131           39 KLCQVRLVKSPKPECSEIVADGLSSARIDLT   69 (107)
Q Consensus        39 ~~C~V~LvsSP~~~C~~~~~~~r~~a~V~Lt   69 (107)
                      .|=.|.+-.|..=.|...+. ....+.+.||
T Consensus        65 ~I~~v~~~DsG~Y~C~~~~~-~~~~~~~~~~   94 (95)
T cd05717          65 SISNVSLSDEGRYTCSLYTM-PVQTAKATVT   94 (95)
T ss_pred             EEccCCcccCEEEEEEEecC-CCceEEEEEE
Confidence            44444444555556665554 3335555554


No 41 
>PF10440 WIYLD:  Ubiquitin-binding WIYLD domain;  InterPro: IPR018848  This entry represents a presumed domain which has been predicted to contain three alpha helices. It was named the WIYLD domain based on the pattern of the ost conserved residues []. This domain appears to be specific to plant SET-domain proteins. ; GO: 0018024 histone-lysine N-methyltransferase activity
Probab=20.90  E-value=39  Score=21.80  Aligned_cols=23  Identities=30%  Similarity=0.374  Sum_probs=20.5

Q ss_pred             ecCCCccccCCchhHHHHHHHhc
Q 045131           82 ANDLGFMKKESLPECAKVLEEMF  104 (107)
Q Consensus        82 aN~lgF~~~~pl~~C~~~lk~~~  104 (107)
                      -.+|||-++...|.=.++|+.||
T Consensus        18 m~~lG~~~~~v~~vl~~LL~lY~   40 (65)
T PF10440_consen   18 MRQLGFSKKQVRPVLKNLLKLYD   40 (65)
T ss_pred             HHHcCCCHHHHHHHHHHHHHHHc
Confidence            34899999999999999999987


No 42 
>PF02369 Big_1:  Bacterial Ig-like domain (group 1);  InterPro: IPR003344 Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins. Intimin is a bacterial cell-adhesion molecule that mediates the intimate bacterial host-cell interaction. It contains three domains; two immunoglobulin-like domains and a C-type lectin-like module implying that carbohydrate recognition may be important in intimin-mediated cell adhesion [].; PDB: 1CWV_A 4E9L_A 1F02_I 1F00_I.
Probab=20.76  E-value=81  Score=20.90  Aligned_cols=19  Identities=16%  Similarity=0.358  Sum_probs=12.9

Q ss_pred             EEEcCCCeeEEEEecCCCc
Q 045131           20 EVVSDQSGTYKIPIEGCHA   38 (107)
Q Consensus        20 e~~TD~~G~y~i~v~~dh~   38 (107)
                      ...||++|.+.+.+.....
T Consensus        61 ~~~Td~~G~a~~tltst~a   79 (100)
T PF02369_consen   61 SATTDSNGIATVTLTSTKA   79 (100)
T ss_dssp             -EEE-TTSEEEEEEE-SS-
T ss_pred             ccEECCCEEEEEEEEecCc
Confidence            4789999999998876643


No 43 
>PF00576 Transthyretin:  HIUase/Transthyretin family;  InterPro: IPR023416 This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain. However, most of the sequences listed in this family do not bind thyroid hormones. They are actually enzymes of the purine catabolism that catalyse the conversion of 5-hydroxyisourate (HIU) to OHCU [, ]. HIU hydrolysis is the original function of the family and is conserved from bacteria to mammals; transthyretins arose by gene duplications in the vertebrate lineage [, ]. HIUases are distinguished in the alignment from the conserved C-terminal YRGS sequence. Transthyretin (formerly prealbumin) is one of 3 thyroid hormone-binding proteins found in the blood of vertebrates []. It is produced in the liver and circulates in the bloodstream, where it binds retinol and thyroxine (T4) []. It differs from the other 2 hormone-binding proteins (T4-binding globulin and albumin) in 3 distinct ways: (1) the gene is expressed at a high rate in the brain choroid plexus; (2) it is enriched in cerebrospinal fluid; and (3) no genetically caused absence has been observed, suggesting an essential role in brain function, distinct from that played in the bloodstream []. The protein consists of around 130 amino acids, which assemble as a homotetramer that contains an internal channel in which T4 is bound. Within this complex, T4 appears to be transported across the blood-brain barrier, where, in the choroid plexus, the hormone stimulates further synthesis of transthyretin. The protein then diffuses back into the bloodstream, where it binds T4 for transport back to the brain [].; PDB: 1TFP_B 1KGJ_D 1IE4_C 1GKE_C 1KGI_D 2H0J_B 2H0E_B 2H0F_B 1ZD6_A 3DGD_D ....
Probab=20.35  E-value=1.6e+02  Score=20.44  Aligned_cols=28  Identities=29%  Similarity=0.296  Sum_probs=19.6

Q ss_pred             eEEEEeecCCCCceEEEEEEEcCCCeeEE
Q 045131            2 TVALECKESEGGEVVYSREVVSDQSGTYK   30 (107)
Q Consensus         2 ~V~leCk~~~~~~v~~~~e~~TD~~G~y~   30 (107)
                      .|+|.=.+ ..+.-+.-.+++||++|..+
T Consensus        20 ~V~L~~~~-~~~~~~~l~~~~Td~DGR~~   47 (112)
T PF00576_consen   20 PVTLYRLD-SDGSWTLLAEGVTDADGRIK   47 (112)
T ss_dssp             EEEEEEEE-TTSCEEEEEEEEBETTSEES
T ss_pred             EEEEEEec-CCCCcEEEEEEEECCCCccc
Confidence            35555444 25667788899999998763


No 44 
>COG2885 OmpA Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane]
Probab=20.29  E-value=63  Score=23.51  Aligned_cols=20  Identities=20%  Similarity=0.245  Sum_probs=15.2

Q ss_pred             ceEEEEEEEcCCCee--EEEEe
Q 045131           14 EVVYSREVVSDQSGT--YKIPI   33 (107)
Q Consensus        14 ~v~~~~e~~TD~~G~--y~i~v   33 (107)
                      .....+||.||+.|.  |++.+
T Consensus       114 ~~~i~V~GHTD~~Gs~~yN~~L  135 (190)
T COG2885         114 ITRILVEGHTDSTGSDEYNQAL  135 (190)
T ss_pred             CcEEEEEecCCCCCCHHHhHHH
Confidence            567889999999996  44443


No 45 
>PF11589 DUF3244:  Domain of unknown function (DUF3244);  InterPro: IPR021638  This family of proteins with unknown function appear to be restricted to Bacteroidetes. The protein may have an immunoglobulin-like beta-sandwich fold however this cannot be confirmed. ; PDB: 3D33_B 3SD2_A.
Probab=20.25  E-value=2e+02  Score=19.14  Aligned_cols=34  Identities=29%  Similarity=0.503  Sum_probs=20.9

Q ss_pred             eEEEEeecCCCCceEEEEEEEcCCCeeEEEEecCC
Q 045131            2 TVALECKESEGGEVVYSREVVSDQSGTYKIPIEGC   36 (107)
Q Consensus         2 ~V~leCk~~~~~~v~~~~e~~TD~~G~y~i~v~~d   36 (107)
                      .|.+.=+| .+|++.|+....+.....+.|.+++.
T Consensus        49 ~vtI~I~d-~~G~vVy~~~~~~~~~~~~~I~L~~~   82 (106)
T PF11589_consen   49 DVTITIKD-STGNVVYSETVSNSAGQSITIDLNGL   82 (106)
T ss_dssp             EEEEEEEE-TT--EEEEEEESCGGTTEEEEE-TTS
T ss_pred             CEEEEEEe-CCCCEEEEEEccCCCCcEEEEEeCCC
Confidence            45666677 67888888777666665666666543


No 46 
>PF04151 PPC:  Bacterial pre-peptidase C-terminal domain;  InterPro: IPR007280 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  This domain is normally found at the C terminus of secreted archaeal and bacterial peptidases, the majority of which belong to MEROPS peptidase families M4 (vibriolysin, IPR001570 from INTERPRO), M9A amd M9B (microbial collangenase, IPR002169 from INTERPRO), M28 (aminopeptidase Ap1, IPR007484 from INTERPRO) and S8 (subtilisin family peptidases, IPR000209 from INTERPRO).; GO: 0008233 peptidase activity, 0006508 proteolysis; PDB: 4DY5_B 4DXZ_A 4DY3_B 3JQW_A 3JQX_C 1NQJ_B 1NQD_A 2O8O_A 1WMF_A 1WME_A ....
Probab=20.07  E-value=81  Score=19.16  Aligned_cols=13  Identities=38%  Similarity=0.672  Sum_probs=10.2

Q ss_pred             cCCCeeEEEEecC
Q 045131           23 SDQSGTYKIPIEG   35 (107)
Q Consensus        23 TD~~G~y~i~v~~   35 (107)
                      .-+.|+|.|.|.+
T Consensus        58 ~~~~GtYyi~V~~   70 (70)
T PF04151_consen   58 APAAGTYYIRVYG   70 (70)
T ss_dssp             ESSSEEEEEEEE-
T ss_pred             cCCCEEEEEEEEC
Confidence            3789999999864


Done!