Query         045143
Match_columns 267
No_of_seqs    119 out of 129
Neff          3.9 
Searched_HMMs 46136
Date          Fri Mar 29 10:15:22 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045143.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045143hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13178 DUF4005:  Protein of u  99.5 2.2E-14 4.8E-19  115.2   5.3   43  222-264    34-79  (102)
  2 PF04822 Takusan:  Takusan;  In   8.4      59  0.0013   25.9  -1.8   35   50-84      2-37  (84)
  3 PF10930 DUF2737:  Protein of u   7.9 1.7E+02  0.0037   21.8   0.6   13  253-265    29-41  (54)
  4 COG1558 FlgC Flagellar basal b   5.4 2.9E+02  0.0063   24.1   0.8   15   15-29     76-90  (137)
  5 PF04686 SsgA:  Streptomyces sp   4.6 2.6E+02  0.0056   22.8  -0.1   16   14-29      2-17  (100)
  6 PRK00807 50S ribosomal protein   3.9 3.7E+02   0.008   19.3   0.3   10   44-53     39-48  (52)
  7 PTZ00269 variant surface glyco   3.5 8.7E+02   0.019   24.9   2.7   24   31-54    394-417 (472)
  8 KOG1741 Mitochondrial/chloropl   2.9 4.9E+02   0.011   21.8   0.1   23  221-246    52-74  (103)
  9 PRK14891 50S ribosomal protein   2.7 5.6E+02   0.012   22.3   0.3   12   43-54     41-52  (131)
 10 cd00472 Ribosomal_L24e_L24 Rib   2.7   6E+02   0.013   18.6   0.4    9   44-52     41-49  (54)

No 1  
>PF13178 DUF4005:  Protein of unknown function (DUF4005)
Probab=99.50  E-value=2.2e-14  Score=115.16  Aligned_cols=43  Identities=47%  Similarity=0.408  Sum_probs=38.3

Q ss_pred             CchhhhhcccccchhcccCCCCCCCCcc---CCCCCCccccCCCCC
Q 045143          222 LPSYIAATESAKGKLRLQGSSRSSEDGV---EKNSGTGCHSRFFSP  264 (267)
Q Consensus       222 ~PsyMa~T~Sakak~r~~~spr~~~~~~---e~~~~~rR~Slp~~~  264 (267)
                      +|+|||+|||||||+|+|++||+++++.   ++....+|+|||...
T Consensus        34 ~PsYMa~TeSakAK~RsqSaPrqR~~~~~~~~~~~~~kR~S~~~~~   79 (102)
T PF13178_consen   34 LPSYMAATESAKAKARSQSAPRQRPGTPERAEKQSSKKRLSLPGSS   79 (102)
T ss_pred             CCCccchhhhhhhhhhccCCcccCCCccccccccccccccccCCCC
Confidence            9999999999999999999999999874   456678999999654


No 2  
>PF04822 Takusan:  Takusan;  InterPro: IPR006907 This family includes several uncharacterised muridae (mouse and rat) proteins.
Probab=8.38  E-value=59  Score=25.89  Aligned_cols=35  Identities=29%  Similarity=0.425  Sum_probs=23.3

Q ss_pred             cccCCCCCCCCCCCCc-hhhhhhccccccccCcCcc
Q 045143           50 KKALSHPADPVDENPQ-SELEKVKRSLRKVNNHLVE   84 (267)
Q Consensus        50 RK~ss~~~ds~~e~pq-~ElEKvKRnlRKvsn~~~e   84 (267)
                      ||.||.+..-...... .++|+.++-|+++++--.|
T Consensus         2 rktSS~~~~ls~~e~~~k~lE~L~~eL~~it~ERnE   37 (84)
T PF04822_consen    2 RKTSSPPPNLSKKEKKMKELERLKFELQKITKERNE   37 (84)
T ss_pred             CCCCCCCCCccHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            6777777743332333 6899999999888774444


No 3  
>PF10930 DUF2737:  Protein of unknown function (DUF2737);  InterPro: IPR020295 The proteins in this entry are uncharacterised.
Probab=7.91  E-value=1.7e+02  Score=21.82  Aligned_cols=13  Identities=8%  Similarity=-0.411  Sum_probs=10.3

Q ss_pred             CCCccccCCCCCC
Q 045143          253 SGTGCHSRFFSPS  265 (267)
Q Consensus       253 ~~~rR~Slp~~~~  265 (267)
                      .-.+|+|||+++.
T Consensus        29 ELlkRnSFpsvn~   41 (54)
T PF10930_consen   29 ELLKRNSFPSVNN   41 (54)
T ss_pred             HHHhhcCCCCCch
Confidence            4568999999874


No 4  
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion]
Probab=5.42  E-value=2.9e+02  Score=24.11  Aligned_cols=15  Identities=27%  Similarity=0.567  Sum_probs=12.9

Q ss_pred             ccccccCCCCCCCCC
Q 045143           15 SLQLQYDSVEPNSVS   29 (267)
Q Consensus        15 pL~Lqyd~~dPNS~~   29 (267)
                      |+.|.||++.|+-.-
T Consensus        76 ~~~~~YdP~hP~Ad~   90 (137)
T COG1558          76 PFKLVYDPGHPDADA   90 (137)
T ss_pred             CceeeeCCCCCCccc
Confidence            789999999998764


No 5  
>PF04686 SsgA:  Streptomyces sporulation and cell division protein, SsgA;  InterPro: IPR006776 The precise function of SsgA is unknown. It is an acidic, cytosolic protein which has been found to be essential for spore formation, and to stimulate cell division in Streptomyces coelicolor [].; PDB: 3CM1_C.
Probab=4.55  E-value=2.6e+02  Score=22.83  Aligned_cols=16  Identities=31%  Similarity=0.713  Sum_probs=11.3

Q ss_pred             cccccccCCCCCCCCC
Q 045143           14 LSLQLQYDSVEPNSVS   29 (267)
Q Consensus        14 ~pL~Lqyd~~dPNS~~   29 (267)
                      +|..|.||+.||--+.
T Consensus         2 V~a~L~Yd~~DP~AV~   17 (100)
T PF04686_consen    2 VPARLRYDPADPYAVR   17 (100)
T ss_dssp             EEEEEEEETTSTTEEE
T ss_pred             ccEEEEEcCCCCEEEE
Confidence            4667888888886553


No 6  
>PRK00807 50S ribosomal protein L24e; Validated
Probab=3.91  E-value=3.7e+02  Score=19.32  Aligned_cols=10  Identities=20%  Similarity=0.119  Sum_probs=8.0

Q ss_pred             cccccccccC
Q 045143           44 RSKRSLKKAL   53 (267)
Q Consensus        44 KpKRn~RK~s   53 (267)
                      +.||||||+.
T Consensus        39 ~~~~nprk~~   48 (52)
T PRK00807         39 KLGRVPRKLK   48 (52)
T ss_pred             HccCCCCccc
Confidence            6789999874


No 7  
>PTZ00269 variant surface glycoprotein; Provisional
Probab=3.54  E-value=8.7e+02  Score=24.92  Aligned_cols=24  Identities=33%  Similarity=0.372  Sum_probs=15.3

Q ss_pred             CCCCcccCCcccccccccccccCC
Q 045143           31 TDSITVHSTPKFERSKRSLKKALS   54 (267)
Q Consensus        31 ~ds~s~qs~~E~eKpKRn~RK~ss   54 (267)
                      ..+.++|+++-.+..||..||.-+
T Consensus       394 ~~~~~~~~~~~~~~~~~~~~~~~~  417 (472)
T PTZ00269        394 DPSDPTQSTTHTNEKKRSVRKPIS  417 (472)
T ss_pred             CCCCCcccccccchhhhhccCCcc
Confidence            344557777777777777777543


No 8  
>KOG1741 consensus Mitochondrial/chloroplast ribosomal protein S14/S29 [Translation, ribosomal structure and biogenesis]
Probab=2.90  E-value=4.9e+02  Score=21.78  Aligned_cols=23  Identities=30%  Similarity=0.192  Sum_probs=14.3

Q ss_pred             CCchhhhhcccccchhcccCCCCCCC
Q 045143          221 SLPSYIAATESAKGKLRLQGSSRSSE  246 (267)
Q Consensus       221 ~~PsyMa~T~Sakak~r~~~spr~~~  246 (267)
                      ++|.||+||.   -+=|-+.+-|+|.
T Consensus        52 alPrns~ptr---I~NRCv~TGR~R~   74 (103)
T KOG1741|consen   52 ALPRNSAPTR---IKNRCVFTGRPRG   74 (103)
T ss_pred             cCccccchHH---HHHHHHhcCCccc
Confidence            6799999873   3444455555553


No 9  
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=2.74  E-value=5.6e+02  Score=22.28  Aligned_cols=12  Identities=8%  Similarity=-0.180  Sum_probs=8.1

Q ss_pred             ccccccccccCC
Q 045143           43 ERSKRSLKKALS   54 (267)
Q Consensus        43 eKpKRn~RK~ss   54 (267)
                      -+.||||||+.=
T Consensus        41 f~~kRnPRKlkW   52 (131)
T PRK14891         41 YDLGREARDLEW   52 (131)
T ss_pred             HHccCCCccchh
Confidence            357788888753


No 10 
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=2.67  E-value=6e+02  Score=18.60  Aligned_cols=9  Identities=33%  Similarity=0.327  Sum_probs=6.8

Q ss_pred             ccccccccc
Q 045143           44 RSKRSLKKA   52 (267)
Q Consensus        44 KpKRn~RK~   52 (267)
                      +-||||||+
T Consensus        41 ~~krnPRkv   49 (54)
T cd00472          41 LRKRNPRKL   49 (54)
T ss_pred             HCcCCCCcc
Confidence            358888886


Done!