BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 045156
(319 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis
Coenzyme A- Disulfide Reductase: A Structural Analysis
Of Dual Nad(p)h Specificity
pdb|3CGC|B Chain B, Pyridine Nucleotide Complexes With Bacillus Anthracis
Coenzyme A- Disulfide Reductase: A Structural Analysis
Of Dual Nad(p)h Specificity
pdb|3CGD|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis
Coenzyme A- Disulfide Reductase: A Structural Analysis
Of Dual Nad(p)h Specificity
pdb|3CGD|B Chain B, Pyridine Nucleotide Complexes With Bacillus Anthracis
Coenzyme A- Disulfide Reductase: A Structural Analysis
Of Dual Nad(p)h Specificity
pdb|3CGE|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis
Coenzyme A- Disulfide Reductase: A Structural Analysis
Of Dual Nad(P)h Specificity
pdb|3CGE|B Chain B, Pyridine Nucleotide Complexes With Bacillus Anthracis
Coenzyme A- Disulfide Reductase: A Structural Analysis
Of Dual Nad(P)h Specificity
Length = 480
Score = 29.3 bits (64), Expect = 3.0, Method: Compositional matrix adjust.
Identities = 12/40 (30%), Positives = 23/40 (57%)
Query: 139 LITFGEKPELHLVEGDDLKSKTRFVSNVNWDMNTDFQEVF 178
L++ G KP +EG ++++ + VN M T+ Q+V+
Sbjct: 275 LVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVY 314
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.135 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,510,540
Number of Sequences: 62578
Number of extensions: 394412
Number of successful extensions: 944
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 943
Number of HSP's gapped (non-prelim): 2
length of query: 319
length of database: 14,973,337
effective HSP length: 99
effective length of query: 220
effective length of database: 8,778,115
effective search space: 1931185300
effective search space used: 1931185300
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)