BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045156
         (319 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis
           Coenzyme A- Disulfide Reductase: A Structural Analysis
           Of Dual Nad(p)h Specificity
 pdb|3CGC|B Chain B, Pyridine Nucleotide Complexes With Bacillus Anthracis
           Coenzyme A- Disulfide Reductase: A Structural Analysis
           Of Dual Nad(p)h Specificity
 pdb|3CGD|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis
           Coenzyme A- Disulfide Reductase: A Structural Analysis
           Of Dual Nad(p)h Specificity
 pdb|3CGD|B Chain B, Pyridine Nucleotide Complexes With Bacillus Anthracis
           Coenzyme A- Disulfide Reductase: A Structural Analysis
           Of Dual Nad(p)h Specificity
 pdb|3CGE|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis
           Coenzyme A- Disulfide Reductase: A Structural Analysis
           Of Dual Nad(P)h Specificity
 pdb|3CGE|B Chain B, Pyridine Nucleotide Complexes With Bacillus Anthracis
           Coenzyme A- Disulfide Reductase: A Structural Analysis
           Of Dual Nad(P)h Specificity
          Length = 480

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 23/40 (57%)

Query: 139 LITFGEKPELHLVEGDDLKSKTRFVSNVNWDMNTDFQEVF 178
           L++ G KP    +EG ++++  +    VN  M T+ Q+V+
Sbjct: 275 LVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVY 314


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.135    0.392 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,510,540
Number of Sequences: 62578
Number of extensions: 394412
Number of successful extensions: 944
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 943
Number of HSP's gapped (non-prelim): 2
length of query: 319
length of database: 14,973,337
effective HSP length: 99
effective length of query: 220
effective length of database: 8,778,115
effective search space: 1931185300
effective search space used: 1931185300
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)