BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045187
         (265 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With
           Complexed With The Allosteric Ligand Imp
 pdb|1CE8|C Chain C, Carbamoyl Phosphate Synthetase From Escherichis Coli With
           Complexed With The Allosteric Ligand Imp
 pdb|1CE8|E Chain E, Carbamoyl Phosphate Synthetase From Escherichis Coli With
           Complexed With The Allosteric Ligand Imp
 pdb|1CE8|G Chain G, Carbamoyl Phosphate Synthetase From Escherichis Coli With
           Complexed With The Allosteric Ligand Imp
 pdb|1M6V|A Chain A, Crystal Structure Of The G359f (Small Subunit) Point
           Mutant Of Carbamoyl Phosphate Synthetase
 pdb|1M6V|C Chain C, Crystal Structure Of The G359f (Small Subunit) Point
           Mutant Of Carbamoyl Phosphate Synthetase
 pdb|1M6V|E Chain E, Crystal Structure Of The G359f (Small Subunit) Point
           Mutant Of Carbamoyl Phosphate Synthetase
 pdb|1M6V|G Chain G, Crystal Structure Of The G359f (Small Subunit) Point
           Mutant Of Carbamoyl Phosphate Synthetase
          Length = 1073

 Score = 30.8 bits (68), Expect = 0.83,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 195 QGLFLDPSRNTPKLFHDRRDGWMEIEMGEFFNKNGDGGTLLCSLFDFDRFGTRHG 249
           +GL L P++    L  +   GW E EM    +KN D   ++CS+ +FD  G   G
Sbjct: 194 RGLDLSPTKEL--LIDESLIGWKEYEMEVVRDKN-DNCIIVCSIENFDAMGIHTG 245


>pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli
 pdb|1JDB|E Chain E, Carbamoyl Phosphate Synthetase From Escherichia Coli
 pdb|1JDB|H Chain H, Carbamoyl Phosphate Synthetase From Escherichia Coli
 pdb|1JDB|K Chain K, Carbamoyl Phosphate Synthetase From Escherichia Coli
 pdb|1BXR|A Chain A, Structure Of Carbamoyl Phosphate Synthetase Complexed With
           The Atp Analog Amppnp
 pdb|1BXR|C Chain C, Structure Of Carbamoyl Phosphate Synthetase Complexed With
           The Atp Analog Amppnp
 pdb|1BXR|E Chain E, Structure Of Carbamoyl Phosphate Synthetase Complexed With
           The Atp Analog Amppnp
 pdb|1BXR|G Chain G, Structure Of Carbamoyl Phosphate Synthetase Complexed With
           The Atp Analog Amppnp
 pdb|1C30|A Chain A, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
           Subunit Mutation C269s
 pdb|1C30|C Chain C, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
           Subunit Mutation C269s
 pdb|1C30|E Chain E, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
           Subunit Mutation C269s
 pdb|1C30|G Chain G, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
           Subunit Mutation C269s
 pdb|1C3O|A Chain A, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
           Small Subunit Mutant C269s With Bound Glutamine
 pdb|1C3O|C Chain C, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
           Small Subunit Mutant C269s With Bound Glutamine
 pdb|1C3O|E Chain E, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
           Small Subunit Mutant C269s With Bound Glutamine
 pdb|1C3O|G Chain G, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
           Small Subunit Mutant C269s With Bound Glutamine
 pdb|1CS0|A Chain A, Crystal Structure Of Carbamoyl Phosphate Synthetase
           Complexed At Cys269 In The Small Subunit With The
           Tetrahedral Mimic L-glutamate Gamma-semialdehyde
 pdb|1CS0|C Chain C, Crystal Structure Of Carbamoyl Phosphate Synthetase
           Complexed At Cys269 In The Small Subunit With The
           Tetrahedral Mimic L-glutamate Gamma-semialdehyde
 pdb|1CS0|E Chain E, Crystal Structure Of Carbamoyl Phosphate Synthetase
           Complexed At Cys269 In The Small Subunit With The
           Tetrahedral Mimic L-glutamate Gamma-semialdehyde
 pdb|1CS0|G Chain G, Crystal Structure Of Carbamoyl Phosphate Synthetase
           Complexed At Cys269 In The Small Subunit With The
           Tetrahedral Mimic L-glutamate Gamma-semialdehyde
 pdb|1KEE|A Chain A, Inactivation Of The Amidotransferase Activity Of Carbamoyl
           Phosphate Synthetase By The Antibiotic Acivicin
 pdb|1KEE|C Chain C, Inactivation Of The Amidotransferase Activity Of Carbamoyl
           Phosphate Synthetase By The Antibiotic Acivicin
 pdb|1KEE|E Chain E, Inactivation Of The Amidotransferase Activity Of Carbamoyl
           Phosphate Synthetase By The Antibiotic Acivicin
 pdb|1KEE|G Chain G, Inactivation Of The Amidotransferase Activity Of Carbamoyl
           Phosphate Synthetase By The Antibiotic Acivicin
 pdb|1T36|A Chain A, Crystal Structure Of E. Coli Carbamoyl Phosphate
           Synthetase Small Subunit Mutant C248d Complexed With
           Uridine 5'-Monophosphate
 pdb|1T36|C Chain C, Crystal Structure Of E. Coli Carbamoyl Phosphate
           Synthetase Small Subunit Mutant C248d Complexed With
           Uridine 5'-Monophosphate
 pdb|1T36|E Chain E, Crystal Structure Of E. Coli Carbamoyl Phosphate
           Synthetase Small Subunit Mutant C248d Complexed With
           Uridine 5'-Monophosphate
 pdb|1T36|G Chain G, Crystal Structure Of E. Coli Carbamoyl Phosphate
           Synthetase Small Subunit Mutant C248d Complexed With
           Uridine 5'-Monophosphate
          Length = 1073

 Score = 30.8 bits (68), Expect = 0.83,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 195 QGLFLDPSRNTPKLFHDRRDGWMEIEMGEFFNKNGDGGTLLCSLFDFDRFGTRHG 249
           +GL L P++    L  +   GW E EM    +KN D   ++CS+ +FD  G   G
Sbjct: 194 RGLDLSPTKEL--LIDESLIGWKEYEMEVVRDKN-DNCIIVCSIENFDAMGIHTG 245


>pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of
           Glutamine Hydrolysis
 pdb|1A9X|C Chain C, Carbamoyl Phosphate Synthetase: Caught In The Act Of
           Glutamine Hydrolysis
 pdb|1A9X|E Chain E, Carbamoyl Phosphate Synthetase: Caught In The Act Of
           Glutamine Hydrolysis
 pdb|1A9X|G Chain G, Carbamoyl Phosphate Synthetase: Caught In The Act Of
           Glutamine Hydrolysis
          Length = 1073

 Score = 30.8 bits (68), Expect = 0.83,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 195 QGLFLDPSRNTPKLFHDRRDGWMEIEMGEFFNKNGDGGTLLCSLFDFDRFGTRHG 249
           +GL L P++    L  +   GW E EM    +KN D   ++CS+ +FD  G   G
Sbjct: 194 RGLDLSPTKEL--LIDESLIGWKEYEMEVVRDKN-DNCIIVCSIENFDAMGIHTG 245


>pdb|3K7X|A Chain A, Crystal Structure Of The Lin0763 Protein From Listeria
           Innocua. Northeast Structural Genomics Consortium Target
           Lkr23
          Length = 349

 Score = 27.3 bits (59), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 30/92 (32%)

Query: 87  NGTMSFELEKETGKKCYMVGAR----DLC-IGWG-----------------STP------ 118
           N   ++ L K TGK  Y+  A+    DL   GW                  +TP      
Sbjct: 97  NALAAYRLYKATGKSIYLEDAQLVWQDLVDTGWNDIXGGGFAWRRPQXYYKNTPVNAPFI 156

Query: 119 --SCWKWTSLPESRFPEVAELVYFWFFEVYAR 148
             SCW +  L E+++ E A   Y W  +V  R
Sbjct: 157 ILSCWLYNELNETKYLEWAXKTYEWQTKVLVR 188


>pdb|3L2O|B Chain B, Structure-Based Mechanism Of Dimerization-Dependent
          Ubiquitination By The Scffbx4 Ubiquitin Ligase
          Length = 312

 Score = 27.3 bits (59), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 21/45 (46%)

Query: 7  LPAECISHIISLTTPRDACRLAVVSPAFKSAADSVLVWEKFLPSD 51
          LP +   +I+S  +P D C+L   +  +       ++W  FL  D
Sbjct: 8  LPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRD 52


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.140    0.457 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,066,052
Number of Sequences: 62578
Number of extensions: 325838
Number of successful extensions: 983
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 981
Number of HSP's gapped (non-prelim): 8
length of query: 265
length of database: 14,973,337
effective HSP length: 97
effective length of query: 168
effective length of database: 8,903,271
effective search space: 1495749528
effective search space used: 1495749528
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)