BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 045187
(265 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With
Complexed With The Allosteric Ligand Imp
pdb|1CE8|C Chain C, Carbamoyl Phosphate Synthetase From Escherichis Coli With
Complexed With The Allosteric Ligand Imp
pdb|1CE8|E Chain E, Carbamoyl Phosphate Synthetase From Escherichis Coli With
Complexed With The Allosteric Ligand Imp
pdb|1CE8|G Chain G, Carbamoyl Phosphate Synthetase From Escherichis Coli With
Complexed With The Allosteric Ligand Imp
pdb|1M6V|A Chain A, Crystal Structure Of The G359f (Small Subunit) Point
Mutant Of Carbamoyl Phosphate Synthetase
pdb|1M6V|C Chain C, Crystal Structure Of The G359f (Small Subunit) Point
Mutant Of Carbamoyl Phosphate Synthetase
pdb|1M6V|E Chain E, Crystal Structure Of The G359f (Small Subunit) Point
Mutant Of Carbamoyl Phosphate Synthetase
pdb|1M6V|G Chain G, Crystal Structure Of The G359f (Small Subunit) Point
Mutant Of Carbamoyl Phosphate Synthetase
Length = 1073
Score = 30.8 bits (68), Expect = 0.83, Method: Composition-based stats.
Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 195 QGLFLDPSRNTPKLFHDRRDGWMEIEMGEFFNKNGDGGTLLCSLFDFDRFGTRHG 249
+GL L P++ L + GW E EM +KN D ++CS+ +FD G G
Sbjct: 194 RGLDLSPTKEL--LIDESLIGWKEYEMEVVRDKN-DNCIIVCSIENFDAMGIHTG 245
>pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli
pdb|1JDB|E Chain E, Carbamoyl Phosphate Synthetase From Escherichia Coli
pdb|1JDB|H Chain H, Carbamoyl Phosphate Synthetase From Escherichia Coli
pdb|1JDB|K Chain K, Carbamoyl Phosphate Synthetase From Escherichia Coli
pdb|1BXR|A Chain A, Structure Of Carbamoyl Phosphate Synthetase Complexed With
The Atp Analog Amppnp
pdb|1BXR|C Chain C, Structure Of Carbamoyl Phosphate Synthetase Complexed With
The Atp Analog Amppnp
pdb|1BXR|E Chain E, Structure Of Carbamoyl Phosphate Synthetase Complexed With
The Atp Analog Amppnp
pdb|1BXR|G Chain G, Structure Of Carbamoyl Phosphate Synthetase Complexed With
The Atp Analog Amppnp
pdb|1C30|A Chain A, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
Subunit Mutation C269s
pdb|1C30|C Chain C, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
Subunit Mutation C269s
pdb|1C30|E Chain E, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
Subunit Mutation C269s
pdb|1C30|G Chain G, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small
Subunit Mutation C269s
pdb|1C3O|A Chain A, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
Small Subunit Mutant C269s With Bound Glutamine
pdb|1C3O|C Chain C, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
Small Subunit Mutant C269s With Bound Glutamine
pdb|1C3O|E Chain E, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
Small Subunit Mutant C269s With Bound Glutamine
pdb|1C3O|G Chain G, Crystal Structure Of The Carbamoyl Phosphate Synthetase:
Small Subunit Mutant C269s With Bound Glutamine
pdb|1CS0|A Chain A, Crystal Structure Of Carbamoyl Phosphate Synthetase
Complexed At Cys269 In The Small Subunit With The
Tetrahedral Mimic L-glutamate Gamma-semialdehyde
pdb|1CS0|C Chain C, Crystal Structure Of Carbamoyl Phosphate Synthetase
Complexed At Cys269 In The Small Subunit With The
Tetrahedral Mimic L-glutamate Gamma-semialdehyde
pdb|1CS0|E Chain E, Crystal Structure Of Carbamoyl Phosphate Synthetase
Complexed At Cys269 In The Small Subunit With The
Tetrahedral Mimic L-glutamate Gamma-semialdehyde
pdb|1CS0|G Chain G, Crystal Structure Of Carbamoyl Phosphate Synthetase
Complexed At Cys269 In The Small Subunit With The
Tetrahedral Mimic L-glutamate Gamma-semialdehyde
pdb|1KEE|A Chain A, Inactivation Of The Amidotransferase Activity Of Carbamoyl
Phosphate Synthetase By The Antibiotic Acivicin
pdb|1KEE|C Chain C, Inactivation Of The Amidotransferase Activity Of Carbamoyl
Phosphate Synthetase By The Antibiotic Acivicin
pdb|1KEE|E Chain E, Inactivation Of The Amidotransferase Activity Of Carbamoyl
Phosphate Synthetase By The Antibiotic Acivicin
pdb|1KEE|G Chain G, Inactivation Of The Amidotransferase Activity Of Carbamoyl
Phosphate Synthetase By The Antibiotic Acivicin
pdb|1T36|A Chain A, Crystal Structure Of E. Coli Carbamoyl Phosphate
Synthetase Small Subunit Mutant C248d Complexed With
Uridine 5'-Monophosphate
pdb|1T36|C Chain C, Crystal Structure Of E. Coli Carbamoyl Phosphate
Synthetase Small Subunit Mutant C248d Complexed With
Uridine 5'-Monophosphate
pdb|1T36|E Chain E, Crystal Structure Of E. Coli Carbamoyl Phosphate
Synthetase Small Subunit Mutant C248d Complexed With
Uridine 5'-Monophosphate
pdb|1T36|G Chain G, Crystal Structure Of E. Coli Carbamoyl Phosphate
Synthetase Small Subunit Mutant C248d Complexed With
Uridine 5'-Monophosphate
Length = 1073
Score = 30.8 bits (68), Expect = 0.83, Method: Composition-based stats.
Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 195 QGLFLDPSRNTPKLFHDRRDGWMEIEMGEFFNKNGDGGTLLCSLFDFDRFGTRHG 249
+GL L P++ L + GW E EM +KN D ++CS+ +FD G G
Sbjct: 194 RGLDLSPTKEL--LIDESLIGWKEYEMEVVRDKN-DNCIIVCSIENFDAMGIHTG 245
>pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of
Glutamine Hydrolysis
pdb|1A9X|C Chain C, Carbamoyl Phosphate Synthetase: Caught In The Act Of
Glutamine Hydrolysis
pdb|1A9X|E Chain E, Carbamoyl Phosphate Synthetase: Caught In The Act Of
Glutamine Hydrolysis
pdb|1A9X|G Chain G, Carbamoyl Phosphate Synthetase: Caught In The Act Of
Glutamine Hydrolysis
Length = 1073
Score = 30.8 bits (68), Expect = 0.83, Method: Composition-based stats.
Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 195 QGLFLDPSRNTPKLFHDRRDGWMEIEMGEFFNKNGDGGTLLCSLFDFDRFGTRHG 249
+GL L P++ L + GW E EM +KN D ++CS+ +FD G G
Sbjct: 194 RGLDLSPTKEL--LIDESLIGWKEYEMEVVRDKN-DNCIIVCSIENFDAMGIHTG 245
>pdb|3K7X|A Chain A, Crystal Structure Of The Lin0763 Protein From Listeria
Innocua. Northeast Structural Genomics Consortium Target
Lkr23
Length = 349
Score = 27.3 bits (59), Expect = 9.2, Method: Compositional matrix adjust.
Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 30/92 (32%)
Query: 87 NGTMSFELEKETGKKCYMVGAR----DLC-IGWG-----------------STP------ 118
N ++ L K TGK Y+ A+ DL GW +TP
Sbjct: 97 NALAAYRLYKATGKSIYLEDAQLVWQDLVDTGWNDIXGGGFAWRRPQXYYKNTPVNAPFI 156
Query: 119 --SCWKWTSLPESRFPEVAELVYFWFFEVYAR 148
SCW + L E+++ E A Y W +V R
Sbjct: 157 ILSCWLYNELNETKYLEWAXKTYEWQTKVLVR 188
>pdb|3L2O|B Chain B, Structure-Based Mechanism Of Dimerization-Dependent
Ubiquitination By The Scffbx4 Ubiquitin Ligase
Length = 312
Score = 27.3 bits (59), Expect = 9.8, Method: Compositional matrix adjust.
Identities = 12/45 (26%), Positives = 21/45 (46%)
Query: 7 LPAECISHIISLTTPRDACRLAVVSPAFKSAADSVLVWEKFLPSD 51
LP + +I+S +P D C+L + + ++W FL D
Sbjct: 8 LPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRD 52
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.140 0.457
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,066,052
Number of Sequences: 62578
Number of extensions: 325838
Number of successful extensions: 983
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 981
Number of HSP's gapped (non-prelim): 8
length of query: 265
length of database: 14,973,337
effective HSP length: 97
effective length of query: 168
effective length of database: 8,903,271
effective search space: 1495749528
effective search space used: 1495749528
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)