BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045191
         (135 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2YDX|A Chain A, Crystal Structure Of Human S-Adenosylmethionine Synthetase
           2, Beta Subunit
 pdb|2YDX|B Chain B, Crystal Structure Of Human S-Adenosylmethionine Synthetase
           2, Beta Subunit
 pdb|2YDX|C Chain C, Crystal Structure Of Human S-Adenosylmethionine Synthetase
           2, Beta Subunit
 pdb|2YDX|D Chain D, Crystal Structure Of Human S-Adenosylmethionine Synthetase
           2, Beta Subunit
 pdb|2YDX|E Chain E, Crystal Structure Of Human S-Adenosylmethionine Synthetase
           2, Beta Subunit
          Length = 315

 Score = 26.2 bits (56), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 39  LENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCLRSKIAEMERFQQ 91
           LEN L   + RI      +L  E+E L++  + +  + V   +K A M+ +QQ
Sbjct: 145 LENNLGAAVLRI-----PILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQ 192


>pdb|1WGS|A Chain A, Solution Structure Of The Tudor Domain From Mouse
           Hypothetical Protein Homologous To Histone
           Acetyltransferase
          Length = 133

 Score = 25.4 bits (54), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 26  DSLSSLTVKELKQLENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCL 79
           D++   + K L +L  + ER ITR + +KH+    EI  +QK   E++  +  L
Sbjct: 75  DAVQKNSEKYLSELAEQPERKITRNQKRKHD----EINHVQKTYAEMDPTTAAL 124


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.131    0.349 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,299,958
Number of Sequences: 62578
Number of extensions: 104240
Number of successful extensions: 309
Number of sequences better than 100.0: 26
Number of HSP's better than 100.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 275
Number of HSP's gapped (non-prelim): 39
length of query: 135
length of database: 14,973,337
effective HSP length: 88
effective length of query: 47
effective length of database: 9,466,473
effective search space: 444924231
effective search space used: 444924231
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)