BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 045191
(135 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2YDX|A Chain A, Crystal Structure Of Human S-Adenosylmethionine Synthetase
2, Beta Subunit
pdb|2YDX|B Chain B, Crystal Structure Of Human S-Adenosylmethionine Synthetase
2, Beta Subunit
pdb|2YDX|C Chain C, Crystal Structure Of Human S-Adenosylmethionine Synthetase
2, Beta Subunit
pdb|2YDX|D Chain D, Crystal Structure Of Human S-Adenosylmethionine Synthetase
2, Beta Subunit
pdb|2YDX|E Chain E, Crystal Structure Of Human S-Adenosylmethionine Synthetase
2, Beta Subunit
Length = 315
Score = 26.2 bits (56), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 5/53 (9%)
Query: 39 LENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCLRSKIAEMERFQQ 91
LEN L + RI +L E+E L++ + + + V +K A M+ +QQ
Sbjct: 145 LENNLGAAVLRI-----PILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQ 192
>pdb|1WGS|A Chain A, Solution Structure Of The Tudor Domain From Mouse
Hypothetical Protein Homologous To Histone
Acetyltransferase
Length = 133
Score = 25.4 bits (54), Expect = 9.4, Method: Compositional matrix adjust.
Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%)
Query: 26 DSLSSLTVKELKQLENRLERGITRIRSKKHEMLLAEIEFLQKREIELENESVCL 79
D++ + K L +L + ER ITR + +KH+ EI +QK E++ + L
Sbjct: 75 DAVQKNSEKYLSELAEQPERKITRNQKRKHD----EINHVQKTYAEMDPTTAAL 124
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.131 0.349
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,299,958
Number of Sequences: 62578
Number of extensions: 104240
Number of successful extensions: 309
Number of sequences better than 100.0: 26
Number of HSP's better than 100.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 275
Number of HSP's gapped (non-prelim): 39
length of query: 135
length of database: 14,973,337
effective HSP length: 88
effective length of query: 47
effective length of database: 9,466,473
effective search space: 444924231
effective search space used: 444924231
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)