Citrus Sinensis ID: 045194

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MVEEQDKLLPIANVGKIMKQILPPRAKISKEAKQTMQECATEFISFVTGEASDKCHKENRKTVNGDDICWALSTLGFDNYTEAIVRYLHKYREDERERAKNQSKVTATSSNEDKAKESPSHKSREQTTSVQQIDETSSAPSELRALKKGKSSLTNPP
cccHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHcccccccccccHHHHHHccccccccccc
*VEEQDKLLPIANVGKIMKQILPP****SKEAKQTMQECATEFISFVTGEASDKCHKENRKTVNGDDICWALSTLGFDNYTEAIVRYLHKY******************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEEQDKLLPIANVGKIMKQILPPRAKISKEAKQTMQECATEFISFVTGEASDKCHKENRKTVNGDDICWALSTLGFDNYTEAIVRYLHKYREDERERAKNQSKVTATSSNEDKAKESPSHKSREQTTSVQQIDETSSAPSELRALKKGKSSLTNPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear transcription factor Y subunit B-4 Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.probableO04027
Transcriptional activator HAP3 Acts a component of the CCAT-binding factor, which is a transcriptional activator and binds to the upstream activation site (UAS2) of the CYC1 gene and other genes involved in mitochondrial electron transport and activates their expression. Recognizes the sequence 5'-CCAAT-3'.probableP13434

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JFI, chain B
Confidence level:very confident
Coverage over the Query: 5-114
View the alignment between query and template
View the model in PyMOL