Citrus Sinensis ID: 045257

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
KILVLLRDGRKLLGLLRSFDQFANVVLEGACERIIVGDLYCDIPLGLYVIRGENVVLIGELDLEKEELPAHMTCVSTAEIKRAQKAEKDATVLKGSMRKRMEFLDFD
cEEEEEccccEEEEEEEEEcccccEEEEccEEEEEccccccCEEEEEEEEEcccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
KILVLLRDGRKLLGLLRSFDQFANVVLEGACERIIVGDLYCDIPLGLYVIRGENVVLIGELDLEKEELPAHMTCVST***********************MEFLDF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KILVLLRDGRKLLGLLRSFDQFANVVLEGACERIIVGDLYCDIPLGLYVIRGENVVLIGELDLEKEELPAHMTCVSTAEIKRAQKAEKDATVLKGSMRKRMEFLDFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable U6 snRNA-associated Sm-like protein LSm1 Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableQ54W83
U6 snRNA-associated Sm-like protein LSm1 Plays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableQ5E9Z8
U6 snRNA-associated Sm-like protein LSm1 Plays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableO15116

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TH7, chain A
Confidence level:very confident
Coverage over the Query: 1-61
View the alignment between query and template
View the model in PyMOL