Citrus Sinensis ID: 045267


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
MEQTLQAQAAPHIVLLPSPGMGHLIPLIEFAKRLVHRHHFLVTFFIPSDGPPSEAQKSTLESLPSSINSVFLPVSLNDVAEDARAETVISLTVLRSLPCLRQELTSLVAKATVAALVVDLFGTDAFDVAQEFNISPYIFYPSTAMCLSLFLHLEKLDQMVPRDCEYRDMSEPVQIPGCIPVHGGYLLDPVQDRKNEAYRWVLHHAKRYKLAEGIIVNSFTDLEGGALKALQHQDEPGKPPVYPVGPLVKTGSTAESKNEGCLKWLDDQPLGSVLFVSFGSGGTLSCEQLNELALGLEMSEQRFLWVVRSPNNAANSTFFSVNSHKDPYDFLPKGFLDRTKGRGMLVPSWAPQAQVLSHGSTGGFLCHCGWNSVLESVVNGVPLIAWPLYAEQKMNAVILTEDVKLALRPKANENGIVGRDEIAKVVKALMEGEQGKEVRNKMKDLKDAAAAVLSENGSSTKALSQLASKWNNNEGKPCSLQI
cccccccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHcccccEEEEcHHHHHHHHHHcHHHHccccccccccccccccCCcccccccccccccccccccccHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccHHHHHHccccEEEcccccHHHHHccccccEEccccccHHHHHHHHcccccccccccccccHHHHHHHHHHcEEEEccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccc
***********HIVLLPSPGMGHLIPLIEFAKRLVHRHHFLVTFFIPSDG***************SINSVFLPVSLNDVAEDARAETVISLTVLRSLPCLRQELTSLVAKATVAALVVDLFGTDAFDVAQEFNISPYIFYPSTAMCLSLFLHLEKLDQMVPRDCEYRDMSEPVQIPGCIPVHGGYLLDPVQDRKNEAYRWVLHHAKRYKLAEGIIVNSFTDLEGGALKALQHQDEPGKPPVYPVG*************EGCLKWLDDQPLGSVLFVSFGSGGTLSCEQLNELALGLEMSEQRFLWVVRSPNNAANSTFFSVNSHKDPYDFLPKGFLDRTKGRGMLVPSWAPQAQVLSHGSTGGFLCHCGWNSVLESVVNGVPLIAWPLYAEQKMNAVILTEDVKLALRPKANENGIVGRDEIAKVVKALMEGEQGKEVRNKMKDLKDAAAAVLSENGSSTKALSQLASKWNNNEG*P*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQTLQAQAAPHIVLLPSPGMGHLIPLIEFAKRLVHRHHFLVTFFIPSDGPPSEAQKSTLESLPSSINSVFLPVSLNDVAEDARAETVISLTVLRSLPCLRQELTSLVAKATVAALVVDLFGTDAFDVAQEFNISPYIFYPSTAMCLSLFLHLEKLDQMVPRDCEYRDMSEPVQIPGCIPVHGGYLLDPVQDRKNEAYRWVLHHAKRYKLAEGIIVNSFTDLEGGALKALQHQDEPGKPPVYPVGPLVKTGSTAESKNEGCLKWLDDQPLGSVLFVSFGSGGTLSCEQLNELALGLEMSEQRFLWVVRSPNNAANSTFFSVNSHKDPYDFLPKGFLDRTKGRGMLVPSWAPQAQVLSHGSTGGFLCHCGWNSVLESVVNGVPLIAWPLYAEQKMNAVILTEDVKLALRPKANENGIVGRDEIAKVVKALMEGEQGKEVRNKMKDLKDAAAAVLSENGSSTKALSQLASKWNNNEGKPCSLQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-glycosyltransferase 72B1 Bifunctional O-glycosyltransferase and N-glycosyltransferase that can detoxify xenobiotics. Possesses high activity to metabolize the peristent pollutants 2,4,5-trichlorophenol (TCP) and 3,4-dichloroaniline (DCA). Also active on benzoates and benzoate derivatives in vitro.probableQ9M156
Hydroquinone glucosyltransferase Broad spectrum multifunctional glucosyltransferase. In addition to hydroquinone it accept at least 45 natural and synthetic phenols as well as two cinnamyl alcohols as substrates. Hydroquinone was however the best substrate. In contrast to this broad acceptor substrate specificity, only pyrimidine nucleotide activated glucose is tolerated as a donor substrate.probableQ9AR73

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.218Hydroquinone glucosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VCH, chain A
Confidence level:very confident
Coverage over the Query: 10-472
View the alignment between query and template
View the model in PyMOL