BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045305
         (93 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9KC26|BIOB_BACHD Biotin synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM
           18197 / FERM 7344 / JCM 9153 / C-125) GN=bioB PE=3 SV=1
          Length = 333

 Score = 30.0 bits (66), Expect = 3.9,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 26  RNLKISKSLKCAKCL--LSPDGQSKFKPIARDTNNHDASPSLLHHGTKTT 73
           R +K +  LK   CL  L P+   + K    D  NH+ + S  HH   TT
Sbjct: 129 REIKDTYGLKICACLGILKPEQAEQLKAAGVDRYNHNVNTSARHHDQITT 178


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.136    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,520,759
Number of Sequences: 539616
Number of extensions: 1365494
Number of successful extensions: 2357
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 2357
Number of HSP's gapped (non-prelim): 4
length of query: 93
length of database: 191,569,459
effective HSP length: 63
effective length of query: 30
effective length of database: 157,573,651
effective search space: 4727209530
effective search space used: 4727209530
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)