Query         045305
Match_columns 93
No_of_seqs    38 out of 40
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 11:54:00 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045305.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045305hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0491 GloB Zn-dependent hydr  56.5     5.4 0.00012   27.6   0.9    8   83-90    144-151 (252)
  2 PF11466 Doppel:  Prion-like pr  42.1      32  0.0007   18.9   2.3   23    6-29      8-30  (30)
  3 PLN02962 hydroxyacylglutathion  38.1      15 0.00032   28.0   0.8    9   81-90    120-128 (251)
  4 PF07127 Nodulin_late:  Late no  37.4      35 0.00077   20.1   2.2   17    1-17      1-18  (54)
  5 PF07172 GRP:  Glycine rich pro  37.2      28 0.00062   23.2   2.0    6    1-6       1-6   (95)
  6 PLN02469 hydroxyacylglutathion  35.4      18 0.00038   27.6   0.8    9   81-90    107-115 (258)
  7 PF05001 RNA_pol_Rpb1_R:  RNA p  35.3      14  0.0003   17.0   0.2    8   82-89      2-9   (14)
  8 PF07265 TAP35_44:  Tapetum spe  27.0      61  0.0013   22.8   2.3   28    1-28      1-33  (119)
  9 PF11587 Prion_bPrPp:  Major pr  25.8      36 0.00078   18.6   0.8   10    1-10      1-10  (29)
 10 PF05399 EVI2A:  Ectropic viral  21.7      61  0.0013   25.3   1.6   17    6-22    131-148 (227)
 11 PRK10241 hydroxyacylglutathion  21.2      43 0.00092   25.1   0.7    7   84-90    107-113 (251)
 12 PLN02398 hydroxyacylglutathion  21.1      45 0.00098   26.7   0.8    7   84-90    184-190 (329)
 13 KOG4065 Uncharacterized conser  20.7      90   0.002   22.6   2.2   20    1-20      1-20  (144)
 14 PF02950 Conotoxin:  Conotoxin;  20.7      33 0.00072   20.8   0.0   10    5-14      2-11  (75)
 15 PRK14758 hypothetical protein;  20.4 1.3E+02  0.0028   16.1   2.3   11    8-18      8-18  (27)

No 1  
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only]
Probab=56.49  E-value=5.4  Score=27.62  Aligned_cols=8  Identities=75%  Similarity=1.585  Sum_probs=6.8

Q ss_pred             CCCCCCCC
Q 045305           83 TTPGHSPG   90 (93)
Q Consensus        83 TtPGHSPG   90 (93)
                      -+|||+||
T Consensus       144 ~tpGHT~g  151 (252)
T COG0491         144 HTPGHTPG  151 (252)
T ss_pred             ECCCCCCC
Confidence            47899998


No 2  
>PF11466 Doppel:  Prion-like protein Doppel;  InterPro: IPR021566  Dpl is a homologue related to the prion protein (PrP). Dpl is toxic to neurons and is expressed in the brains of mice that do not express PrP. In DHPC and SDS micelles, Dpl shoes about 40% alpha-helical structure however in aqueous solution it consists of a random coil. The alpha helical segment can adopt a transmembrane localisation also in a membrane. The unprocessed Dpl protein is thought to posses a possible channel formation mechanism which may be related to toxicity through direct interaction with cell membranes and damage to the cell membrane. ; PDB: 1Z65_A.
Probab=42.08  E-value=32  Score=18.90  Aligned_cols=23  Identities=26%  Similarity=0.390  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHhccccccccccc
Q 045305            6 CTCLFFILMIFSHELCDVEGRNLK   29 (93)
Q Consensus         6 ~~~~~~l~Li~~~~~~~~eGR~Lk   29 (93)
                      +..+++-+|+|||-.. +..|-+|
T Consensus         8 ~~lAi~c~LL~s~Ls~-VkARgiK   30 (30)
T PF11466_consen    8 WWLAIVCVLLFSHLSS-VKARGIK   30 (30)
T ss_dssp             HHHHHHHHHHHHHTTT-T---S--
T ss_pred             HHHHHHHHHHHHHhhH-HHhccCC
Confidence            3455577777887554 6776553


No 3  
>PLN02962 hydroxyacylglutathione hydrolase
Probab=38.11  E-value=15  Score=28.04  Aligned_cols=9  Identities=67%  Similarity=1.335  Sum_probs=7.4

Q ss_pred             cCCCCCCCCC
Q 045305           81 RPTTPGHSPG   90 (93)
Q Consensus        81 RPTtPGHSPG   90 (93)
                      .. +|||+||
T Consensus       120 i~-tPGHT~g  128 (251)
T PLN02962        120 RA-TPGHTAG  128 (251)
T ss_pred             EE-CCCCCcC
Confidence            44 6999998


No 4  
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=37.41  E-value=35  Score=20.10  Aligned_cols=17  Identities=18%  Similarity=0.335  Sum_probs=9.5

Q ss_pred             Ccch-HHHHHHHHHHHHH
Q 045305            1 MANV-SCTCLFFILMIFS   17 (93)
Q Consensus         1 MA~~-~~~~~~~l~Li~~   17 (93)
                      ||+. |..|+++++|.++
T Consensus         1 Ma~ilKFvY~mIiflslf   18 (54)
T PF07127_consen    1 MAKILKFVYAMIIFLSLF   18 (54)
T ss_pred             CccchhhHHHHHHHHHHH
Confidence            7777 4566554444443


No 5  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=37.24  E-value=28  Score=23.22  Aligned_cols=6  Identities=33%  Similarity=0.346  Sum_probs=3.7

Q ss_pred             CcchHH
Q 045305            1 MANVSC    6 (93)
Q Consensus         1 MA~~~~    6 (93)
                      ||-+++
T Consensus         1 MaSK~~    6 (95)
T PF07172_consen    1 MASKAF    6 (95)
T ss_pred             CchhHH
Confidence            885553


No 6  
>PLN02469 hydroxyacylglutathione hydrolase
Probab=35.44  E-value=18  Score=27.57  Aligned_cols=9  Identities=44%  Similarity=0.678  Sum_probs=7.2

Q ss_pred             cCCCCCCCCC
Q 045305           81 RPTTPGHSPG   90 (93)
Q Consensus        81 RPTtPGHSPG   90 (93)
                      .. +|||+||
T Consensus       107 i~-tPGHT~g  115 (258)
T PLN02469        107 LH-TPCHTKG  115 (258)
T ss_pred             EE-CCCCCCC
Confidence            44 5999998


No 7  
>PF05001 RNA_pol_Rpb1_R:  RNA polymerase Rpb1 C-terminal repeat ;  InterPro: IPR000684 RNA polymerase II (2.7.7.6 from EC) [, ] is one of the three forms of RNA polymerase that exist in eukaryotic nuclei. The C-terminal region of the largest subunit of this oligomeric enzyme consists of the tandem repeat of a conserved heptapeptide []. The number of repeats varies according to the species (for example there are 17 in Plasmodium, 26 in yeast, 44 in Drosophila, and 52 in mammals). The region containing these repeats is essential for the function of polymerase II. This repeated heptapeptide (called CT7n or CTD) is rich in hydroxyl groups. It probably projects out of the globular catalytic domain and may interact with the acidic activator domains of transcriptional regulatory proteins. It is also known to bind by intercalation to DNA. RNA polymerase II is activated by phosphorylation. The serine and threonine residues in the CT7n repeats are the target of such phosphorylation.; GO: 0003677 DNA binding, 0006366 transcription from RNA polymerase II promoter, 0005665 DNA-directed RNA polymerase II, core complex; PDB: 2L0I_B 2GHQ_C 2GHT_C.
Probab=35.28  E-value=14  Score=17.02  Aligned_cols=8  Identities=75%  Similarity=1.389  Sum_probs=2.4

Q ss_pred             CCCCCCCC
Q 045305           82 PTTPGHSP   89 (93)
Q Consensus        82 PTtPGHSP   89 (93)
                      ||.|+-||
T Consensus         2 P~SP~ysP    9 (14)
T PF05001_consen    2 PTSPGYSP    9 (14)
T ss_dssp             TTB---BT
T ss_pred             CCCCCCCc
Confidence            44555444


No 8  
>PF07265 TAP35_44:  Tapetum specific protein TAP35/TAP44;  InterPro: IPR009891 This family consists of several plant tapetum specific proteins. Members of this family are found in Arabidopsis thaliana, Brassica napus and Sinapis alba. Members of this family may be involved in sporopollenin formation and/or deposition [].
Probab=26.98  E-value=61  Score=22.77  Aligned_cols=28  Identities=18%  Similarity=0.484  Sum_probs=13.1

Q ss_pred             CcchH---HHHHHHHHHHHH--hcccccccccc
Q 045305            1 MANVS---CTCLFFILMIFS--HELCDVEGRNL   28 (93)
Q Consensus         1 MA~~~---~~~~~~l~Li~~--~~~~~~eGR~L   28 (93)
                      |.+..   ++|++|++.+|.  |-.++..+-++
T Consensus         1 MS~iSk~sslcLlll~~ff~sS~pa~slR~pk~   33 (119)
T PF07265_consen    1 MSKISKVSSLCLLLLVVFFLSSQPALSLRSPKP   33 (119)
T ss_pred             CchhHHHHHHHHHHHHHHHHcCchhhhhcCCcc
Confidence            55553   566665553333  33334433343


No 9  
>PF11587 Prion_bPrPp:  Major prion protein bPrPp - N terminal; PDB: 1SKH_A.
Probab=25.77  E-value=36  Score=18.58  Aligned_cols=10  Identities=20%  Similarity=0.441  Sum_probs=4.9

Q ss_pred             CcchHHHHHH
Q 045305            1 MANVSCTCLF   10 (93)
Q Consensus         1 MA~~~~~~~~   10 (93)
                      |++..+.|-+
T Consensus         1 M~k~~lgcWi   10 (29)
T PF11587_consen    1 MVKSHLGCWI   10 (29)
T ss_dssp             --TTTTTTHH
T ss_pred             CccccccHHH
Confidence            7887655544


No 10 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=21.75  E-value=61  Score=25.28  Aligned_cols=17  Identities=18%  Similarity=0.335  Sum_probs=11.5

Q ss_pred             HHHHH-HHHHHHHhcccc
Q 045305            6 CTCLF-FILMIFSHELCD   22 (93)
Q Consensus         6 ~~~~~-~l~Li~~~~~~~   22 (93)
                      ++|++ +.+|||++-+++
T Consensus       131 LIClIIIAVLfLICT~Lf  148 (227)
T PF05399_consen  131 LICLIIIAVLFLICTLLF  148 (227)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            57777 667777776664


No 11 
>PRK10241 hydroxyacylglutathione hydrolase; Provisional
Probab=21.22  E-value=43  Score=25.11  Aligned_cols=7  Identities=71%  Similarity=1.355  Sum_probs=6.2

Q ss_pred             CCCCCCC
Q 045305           84 TPGHSPG   90 (93)
Q Consensus        84 tPGHSPG   90 (93)
                      +|||+||
T Consensus       107 tPGHT~g  113 (251)
T PRK10241        107 TPGHTLG  113 (251)
T ss_pred             cCCCCcc
Confidence            6999997


No 12 
>PLN02398 hydroxyacylglutathione hydrolase
Probab=21.06  E-value=45  Score=26.70  Aligned_cols=7  Identities=71%  Similarity=1.422  Sum_probs=6.2

Q ss_pred             CCCCCCC
Q 045305           84 TPGHSPG   90 (93)
Q Consensus        84 tPGHSPG   90 (93)
                      +|||+||
T Consensus       184 tPGHT~G  190 (329)
T PLN02398        184 TPGHTRG  190 (329)
T ss_pred             CCCcCCC
Confidence            5999998


No 13 
>KOG4065 consensus Uncharacterized conserved protein [Function unknown]
Probab=20.73  E-value=90  Score=22.57  Aligned_cols=20  Identities=20%  Similarity=0.358  Sum_probs=15.6

Q ss_pred             CcchHHHHHHHHHHHHHhcc
Q 045305            1 MANVSCTCLFFILMIFSHEL   20 (93)
Q Consensus         1 MA~~~~~~~~~l~Li~~~~~   20 (93)
                      |+-+.++..+|++++||+.-
T Consensus         1 M~~~~li~tc~lL~~f~aqg   20 (144)
T KOG4065|consen    1 MRGFLLISTCFLLLVFEAQG   20 (144)
T ss_pred             CcchhHHHHHHHHHHHhcCh
Confidence            77777888888888888643


No 14 
>PF02950 Conotoxin:  Conotoxin;  InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus.  The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=20.69  E-value=33  Score=20.82  Aligned_cols=10  Identities=20%  Similarity=0.697  Sum_probs=0.0

Q ss_pred             HHHHHHHHHH
Q 045305            5 SCTCLFFILM   14 (93)
Q Consensus         5 ~~~~~~~l~L   14 (93)
                      |+.+++|+++
T Consensus         2 KLt~vliVav   11 (75)
T PF02950_consen    2 KLTCVLIVAV   11 (75)
T ss_dssp             ----------
T ss_pred             CcchHHHHHH
Confidence            5666553333


No 15 
>PRK14758 hypothetical protein; Provisional
Probab=20.39  E-value=1.3e+02  Score=16.10  Aligned_cols=11  Identities=18%  Similarity=0.513  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHh
Q 045305            8 CLFFILMIFSH   18 (93)
Q Consensus         8 ~~~~l~Li~~~   18 (93)
                      =+++++||+|-
T Consensus         8 EliLivlIlCa   18 (27)
T PRK14758          8 EFILIILILCA   18 (27)
T ss_pred             HHHHHHHHHHH
Confidence            34566666663


Done!