Query 045305
Match_columns 93
No_of_seqs 38 out of 40
Neff 4.8
Searched_HMMs 46136
Date Fri Mar 29 11:54:00 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045305.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045305hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG0491 GloB Zn-dependent hydr 56.5 5.4 0.00012 27.6 0.9 8 83-90 144-151 (252)
2 PF11466 Doppel: Prion-like pr 42.1 32 0.0007 18.9 2.3 23 6-29 8-30 (30)
3 PLN02962 hydroxyacylglutathion 38.1 15 0.00032 28.0 0.8 9 81-90 120-128 (251)
4 PF07127 Nodulin_late: Late no 37.4 35 0.00077 20.1 2.2 17 1-17 1-18 (54)
5 PF07172 GRP: Glycine rich pro 37.2 28 0.00062 23.2 2.0 6 1-6 1-6 (95)
6 PLN02469 hydroxyacylglutathion 35.4 18 0.00038 27.6 0.8 9 81-90 107-115 (258)
7 PF05001 RNA_pol_Rpb1_R: RNA p 35.3 14 0.0003 17.0 0.2 8 82-89 2-9 (14)
8 PF07265 TAP35_44: Tapetum spe 27.0 61 0.0013 22.8 2.3 28 1-28 1-33 (119)
9 PF11587 Prion_bPrPp: Major pr 25.8 36 0.00078 18.6 0.8 10 1-10 1-10 (29)
10 PF05399 EVI2A: Ectropic viral 21.7 61 0.0013 25.3 1.6 17 6-22 131-148 (227)
11 PRK10241 hydroxyacylglutathion 21.2 43 0.00092 25.1 0.7 7 84-90 107-113 (251)
12 PLN02398 hydroxyacylglutathion 21.1 45 0.00098 26.7 0.8 7 84-90 184-190 (329)
13 KOG4065 Uncharacterized conser 20.7 90 0.002 22.6 2.2 20 1-20 1-20 (144)
14 PF02950 Conotoxin: Conotoxin; 20.7 33 0.00072 20.8 0.0 10 5-14 2-11 (75)
15 PRK14758 hypothetical protein; 20.4 1.3E+02 0.0028 16.1 2.3 11 8-18 8-18 (27)
No 1
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only]
Probab=56.49 E-value=5.4 Score=27.62 Aligned_cols=8 Identities=75% Similarity=1.585 Sum_probs=6.8
Q ss_pred CCCCCCCC
Q 045305 83 TTPGHSPG 90 (93)
Q Consensus 83 TtPGHSPG 90 (93)
-+|||+||
T Consensus 144 ~tpGHT~g 151 (252)
T COG0491 144 HTPGHTPG 151 (252)
T ss_pred ECCCCCCC
Confidence 47899998
No 2
>PF11466 Doppel: Prion-like protein Doppel; InterPro: IPR021566 Dpl is a homologue related to the prion protein (PrP). Dpl is toxic to neurons and is expressed in the brains of mice that do not express PrP. In DHPC and SDS micelles, Dpl shoes about 40% alpha-helical structure however in aqueous solution it consists of a random coil. The alpha helical segment can adopt a transmembrane localisation also in a membrane. The unprocessed Dpl protein is thought to posses a possible channel formation mechanism which may be related to toxicity through direct interaction with cell membranes and damage to the cell membrane. ; PDB: 1Z65_A.
Probab=42.08 E-value=32 Score=18.90 Aligned_cols=23 Identities=26% Similarity=0.390 Sum_probs=11.6
Q ss_pred HHHHHHHHHHHHhccccccccccc
Q 045305 6 CTCLFFILMIFSHELCDVEGRNLK 29 (93)
Q Consensus 6 ~~~~~~l~Li~~~~~~~~eGR~Lk 29 (93)
+..+++-+|+|||-.. +..|-+|
T Consensus 8 ~~lAi~c~LL~s~Ls~-VkARgiK 30 (30)
T PF11466_consen 8 WWLAIVCVLLFSHLSS-VKARGIK 30 (30)
T ss_dssp HHHHHHHHHHHHHTTT-T---S--
T ss_pred HHHHHHHHHHHHHhhH-HHhccCC
Confidence 3455577777887554 6776553
No 3
>PLN02962 hydroxyacylglutathione hydrolase
Probab=38.11 E-value=15 Score=28.04 Aligned_cols=9 Identities=67% Similarity=1.335 Sum_probs=7.4
Q ss_pred cCCCCCCCCC
Q 045305 81 RPTTPGHSPG 90 (93)
Q Consensus 81 RPTtPGHSPG 90 (93)
.. +|||+||
T Consensus 120 i~-tPGHT~g 128 (251)
T PLN02962 120 RA-TPGHTAG 128 (251)
T ss_pred EE-CCCCCcC
Confidence 44 6999998
No 4
>PF07127 Nodulin_late: Late nodulin protein; InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=37.41 E-value=35 Score=20.10 Aligned_cols=17 Identities=18% Similarity=0.335 Sum_probs=9.5
Q ss_pred Ccch-HHHHHHHHHHHHH
Q 045305 1 MANV-SCTCLFFILMIFS 17 (93)
Q Consensus 1 MA~~-~~~~~~~l~Li~~ 17 (93)
||+. |..|+++++|.++
T Consensus 1 Ma~ilKFvY~mIiflslf 18 (54)
T PF07127_consen 1 MAKILKFVYAMIIFLSLF 18 (54)
T ss_pred CccchhhHHHHHHHHHHH
Confidence 7777 4566554444443
No 5
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=37.24 E-value=28 Score=23.22 Aligned_cols=6 Identities=33% Similarity=0.346 Sum_probs=3.7
Q ss_pred CcchHH
Q 045305 1 MANVSC 6 (93)
Q Consensus 1 MA~~~~ 6 (93)
||-+++
T Consensus 1 MaSK~~ 6 (95)
T PF07172_consen 1 MASKAF 6 (95)
T ss_pred CchhHH
Confidence 885553
No 6
>PLN02469 hydroxyacylglutathione hydrolase
Probab=35.44 E-value=18 Score=27.57 Aligned_cols=9 Identities=44% Similarity=0.678 Sum_probs=7.2
Q ss_pred cCCCCCCCCC
Q 045305 81 RPTTPGHSPG 90 (93)
Q Consensus 81 RPTtPGHSPG 90 (93)
.. +|||+||
T Consensus 107 i~-tPGHT~g 115 (258)
T PLN02469 107 LH-TPCHTKG 115 (258)
T ss_pred EE-CCCCCCC
Confidence 44 5999998
No 7
>PF05001 RNA_pol_Rpb1_R: RNA polymerase Rpb1 C-terminal repeat ; InterPro: IPR000684 RNA polymerase II (2.7.7.6 from EC) [, ] is one of the three forms of RNA polymerase that exist in eukaryotic nuclei. The C-terminal region of the largest subunit of this oligomeric enzyme consists of the tandem repeat of a conserved heptapeptide []. The number of repeats varies according to the species (for example there are 17 in Plasmodium, 26 in yeast, 44 in Drosophila, and 52 in mammals). The region containing these repeats is essential for the function of polymerase II. This repeated heptapeptide (called CT7n or CTD) is rich in hydroxyl groups. It probably projects out of the globular catalytic domain and may interact with the acidic activator domains of transcriptional regulatory proteins. It is also known to bind by intercalation to DNA. RNA polymerase II is activated by phosphorylation. The serine and threonine residues in the CT7n repeats are the target of such phosphorylation.; GO: 0003677 DNA binding, 0006366 transcription from RNA polymerase II promoter, 0005665 DNA-directed RNA polymerase II, core complex; PDB: 2L0I_B 2GHQ_C 2GHT_C.
Probab=35.28 E-value=14 Score=17.02 Aligned_cols=8 Identities=75% Similarity=1.389 Sum_probs=2.4
Q ss_pred CCCCCCCC
Q 045305 82 PTTPGHSP 89 (93)
Q Consensus 82 PTtPGHSP 89 (93)
||.|+-||
T Consensus 2 P~SP~ysP 9 (14)
T PF05001_consen 2 PTSPGYSP 9 (14)
T ss_dssp TTB---BT
T ss_pred CCCCCCCc
Confidence 44555444
No 8
>PF07265 TAP35_44: Tapetum specific protein TAP35/TAP44; InterPro: IPR009891 This family consists of several plant tapetum specific proteins. Members of this family are found in Arabidopsis thaliana, Brassica napus and Sinapis alba. Members of this family may be involved in sporopollenin formation and/or deposition [].
Probab=26.98 E-value=61 Score=22.77 Aligned_cols=28 Identities=18% Similarity=0.484 Sum_probs=13.1
Q ss_pred CcchH---HHHHHHHHHHHH--hcccccccccc
Q 045305 1 MANVS---CTCLFFILMIFS--HELCDVEGRNL 28 (93)
Q Consensus 1 MA~~~---~~~~~~l~Li~~--~~~~~~eGR~L 28 (93)
|.+.. ++|++|++.+|. |-.++..+-++
T Consensus 1 MS~iSk~sslcLlll~~ff~sS~pa~slR~pk~ 33 (119)
T PF07265_consen 1 MSKISKVSSLCLLLLVVFFLSSQPALSLRSPKP 33 (119)
T ss_pred CchhHHHHHHHHHHHHHHHHcCchhhhhcCCcc
Confidence 55553 566665553333 33334433343
No 9
>PF11587 Prion_bPrPp: Major prion protein bPrPp - N terminal; PDB: 1SKH_A.
Probab=25.77 E-value=36 Score=18.58 Aligned_cols=10 Identities=20% Similarity=0.441 Sum_probs=4.9
Q ss_pred CcchHHHHHH
Q 045305 1 MANVSCTCLF 10 (93)
Q Consensus 1 MA~~~~~~~~ 10 (93)
|++..+.|-+
T Consensus 1 M~k~~lgcWi 10 (29)
T PF11587_consen 1 MVKSHLGCWI 10 (29)
T ss_dssp --TTTTTTHH
T ss_pred CccccccHHH
Confidence 7887655544
No 10
>PF05399 EVI2A: Ectropic viral integration site 2A protein (EVI2A); InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=21.75 E-value=61 Score=25.28 Aligned_cols=17 Identities=18% Similarity=0.335 Sum_probs=11.5
Q ss_pred HHHHH-HHHHHHHhcccc
Q 045305 6 CTCLF-FILMIFSHELCD 22 (93)
Q Consensus 6 ~~~~~-~l~Li~~~~~~~ 22 (93)
++|++ +.+|||++-+++
T Consensus 131 LIClIIIAVLfLICT~Lf 148 (227)
T PF05399_consen 131 LICLIIIAVLFLICTLLF 148 (227)
T ss_pred HHHHHHHHHHHHHHHHHH
Confidence 57777 667777776664
No 11
>PRK10241 hydroxyacylglutathione hydrolase; Provisional
Probab=21.22 E-value=43 Score=25.11 Aligned_cols=7 Identities=71% Similarity=1.355 Sum_probs=6.2
Q ss_pred CCCCCCC
Q 045305 84 TPGHSPG 90 (93)
Q Consensus 84 tPGHSPG 90 (93)
+|||+||
T Consensus 107 tPGHT~g 113 (251)
T PRK10241 107 TPGHTLG 113 (251)
T ss_pred cCCCCcc
Confidence 6999997
No 12
>PLN02398 hydroxyacylglutathione hydrolase
Probab=21.06 E-value=45 Score=26.70 Aligned_cols=7 Identities=71% Similarity=1.422 Sum_probs=6.2
Q ss_pred CCCCCCC
Q 045305 84 TPGHSPG 90 (93)
Q Consensus 84 tPGHSPG 90 (93)
+|||+||
T Consensus 184 tPGHT~G 190 (329)
T PLN02398 184 TPGHTRG 190 (329)
T ss_pred CCCcCCC
Confidence 5999998
No 13
>KOG4065 consensus Uncharacterized conserved protein [Function unknown]
Probab=20.73 E-value=90 Score=22.57 Aligned_cols=20 Identities=20% Similarity=0.358 Sum_probs=15.6
Q ss_pred CcchHHHHHHHHHHHHHhcc
Q 045305 1 MANVSCTCLFFILMIFSHEL 20 (93)
Q Consensus 1 MA~~~~~~~~~l~Li~~~~~ 20 (93)
|+-+.++..+|++++||+.-
T Consensus 1 M~~~~li~tc~lL~~f~aqg 20 (144)
T KOG4065|consen 1 MRGFLLISTCFLLLVFEAQG 20 (144)
T ss_pred CcchhHHHHHHHHHHHhcCh
Confidence 77777888888888888643
No 14
>PF02950 Conotoxin: Conotoxin; InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus. The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=20.69 E-value=33 Score=20.82 Aligned_cols=10 Identities=20% Similarity=0.697 Sum_probs=0.0
Q ss_pred HHHHHHHHHH
Q 045305 5 SCTCLFFILM 14 (93)
Q Consensus 5 ~~~~~~~l~L 14 (93)
|+.+++|+++
T Consensus 2 KLt~vliVav 11 (75)
T PF02950_consen 2 KLTCVLIVAV 11 (75)
T ss_dssp ----------
T ss_pred CcchHHHHHH
Confidence 5666553333
No 15
>PRK14758 hypothetical protein; Provisional
Probab=20.39 E-value=1.3e+02 Score=16.10 Aligned_cols=11 Identities=18% Similarity=0.513 Sum_probs=6.4
Q ss_pred HHHHHHHHHHh
Q 045305 8 CLFFILMIFSH 18 (93)
Q Consensus 8 ~~~~l~Li~~~ 18 (93)
=+++++||+|-
T Consensus 8 EliLivlIlCa 18 (27)
T PRK14758 8 EFILIILILCA 18 (27)
T ss_pred HHHHHHHHHHH
Confidence 34566666663
Done!