Query         045333
Match_columns 225
No_of_seqs    162 out of 753
Neff          3.6 
Searched_HMMs 46136
Date          Fri Mar 29 12:11:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045333.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045333hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462 C2H2-type Zn-finger pr  98.4 1.2E-07 2.5E-12   86.7   2.2   37   62-98    207-243 (279)
  2 KOG1074 Transcriptional repres  98.4 1.2E-07 2.5E-12   96.8   1.3   40   61-100   624-663 (958)
  3 PHA02768 hypothetical protein;  98.1 1.4E-06 2.9E-11   62.8   1.5   25   70-94      5-29  (55)
  4 PF00096 zf-C2H2:  Zinc finger,  98.0 2.8E-06   6E-11   49.1   1.1   23   71-93      1-23  (23)
  5 PHA00616 hypothetical protein   97.9 2.6E-06 5.6E-11   58.9   0.7   29   70-98      1-29  (44)
  6 KOG2462 C2H2-type Zn-finger pr  97.9 3.3E-06 7.1E-11   77.3   1.0   31   69-99    186-216 (279)
  7 KOG3623 Homeobox transcription  97.9 3.9E-06 8.4E-11   85.4   1.2   36   64-99    916-951 (1007)
  8 PF13912 zf-C2H2_6:  C2H2-type   97.8 7.9E-06 1.7E-10   48.8   1.2   26   70-95      1-26  (27)
  9 KOG1074 Transcriptional repres  97.7 7.1E-05 1.5E-09   77.0   6.5   38   61-98    372-409 (958)
 10 PF13894 zf-C2H2_4:  C2H2-type   97.6 2.7E-05 5.8E-10   44.0   1.5   24   71-94      1-24  (24)
 11 PF13465 zf-H2C2_2:  Zinc-finge  97.6 8.2E-06 1.8E-10   49.6  -1.2   20   63-82      7-26  (26)
 12 smart00355 ZnF_C2H2 zinc finge  97.4 9.8E-05 2.1E-09   41.7   1.6   25   71-95      1-25  (26)
 13 KOG3623 Homeobox transcription  97.3 6.1E-05 1.3E-09   77.0   0.7   33   67-99    278-310 (1007)
 14 PF09237 GAGA:  GAGA factor;  I  96.9 0.00057 1.2E-08   49.3   1.7   34   66-99     20-53  (54)
 15 PF12874 zf-met:  Zinc-finger o  96.8 0.00038 8.3E-09   40.8   0.7   24   71-94      1-24  (25)
 16 KOG3576 Ovo and related transc  96.8 0.00028   6E-09   63.6  -0.5   39   61-99    136-174 (267)
 17 PHA00732 hypothetical protein   96.4  0.0017 3.7E-08   49.2   1.7   27   70-96      1-28  (79)
 18 PHA00733 hypothetical protein   96.0  0.0041 8.9E-08   50.6   2.1   29   66-94     69-97  (128)
 19 PF12171 zf-C2H2_jaz:  Zinc-fin  95.7  0.0033 7.1E-08   38.0   0.3   24   70-93      1-24  (27)
 20 KOG3576 Ovo and related transc  95.6  0.0041   9E-08   56.2   0.8   37   59-95    162-198 (267)
 21 PF12756 zf-C2H2_2:  C2H2 type   94.9   0.015 3.2E-07   42.2   1.7   25   69-93     49-73  (100)
 22 PF13909 zf-H2C2_5:  C2H2-type   94.5   0.017 3.7E-07   33.7   1.0   23   71-94      1-23  (24)
 23 PF13913 zf-C2HC_2:  zinc-finge  94.0   0.029 6.2E-07   34.1   1.2   21   71-92      3-23  (25)
 24 smart00451 ZnF_U1 U1-like zinc  93.8   0.036 7.9E-07   34.3   1.4   23   70-92      3-25  (35)
 25 PHA00733 hypothetical protein   93.0    0.06 1.3E-06   43.8   1.9   28   68-95     97-124 (128)
 26 PF13465 zf-H2C2_2:  Zinc-finge  92.7    0.06 1.3E-06   32.6   1.2   15   85-99      1-15  (26)
 27 KOG3993 Transcription factor (  92.1   0.065 1.4E-06   52.6   1.3   26   70-95    295-320 (500)
 28 KOG2893 Zn finger protein [Gen  91.4   0.037 7.9E-07   51.3  -1.2   36   60-95     24-60  (341)
 29 PHA02768 hypothetical protein;  89.9   0.092   2E-06   38.0  -0.0   24   62-87     25-48  (55)
 30 KOG3608 Zn finger proteins [Ge  88.0    0.26 5.5E-06   47.9   1.5   37   59-95    281-317 (467)
 31 KOG3993 Transcription factor (  87.1    0.24 5.2E-06   48.7   0.8   29   67-95    353-381 (500)
 32 PF02892 zf-BED:  BED zinc fing  85.8    0.53 1.1E-05   30.9   1.7   27   67-93     13-44  (45)
 33 PF05605 zf-Di19:  Drought indu  85.7    0.54 1.2E-05   32.5   1.8   27   70-97      2-29  (54)
 34 COG5189 SFP1 Putative transcri  84.0    0.34 7.4E-06   46.5   0.1   24   67-90    395-418 (423)
 35 smart00614 ZnF_BED BED zinc fi  83.9    0.64 1.4E-05   31.7   1.4   25   70-94     18-48  (50)
 36 PF05605 zf-Di19:  Drought indu  83.2    0.75 1.6E-05   31.8   1.6   26   68-95     29-54  (54)
 37 PLN03086 PRLI-interacting fact  82.3    0.81 1.8E-05   46.1   2.0   28   69-98    477-504 (567)
 38 PRK04860 hypothetical protein;  82.2    0.76 1.6E-05   39.1   1.5   27   69-99    118-144 (160)
 39 PF12756 zf-C2H2_2:  C2H2 type   81.5    0.46   1E-05   34.3   0.0   24   72-95      1-24  (100)
 40 COG5048 FOG: Zn-finger [Genera  80.0    0.71 1.5E-05   39.8   0.6   36   64-99    313-352 (467)
 41 COG4049 Uncharacterized protei  76.6       1 2.2E-05   33.5   0.5   27   66-92     13-39  (65)
 42 KOG2071 mRNA cleavage and poly  76.0     1.3 2.9E-05   44.7   1.4   32   67-98    415-446 (579)
 43 KOG4167 Predicted DNA-binding   75.7    0.72 1.6E-05   48.2  -0.6   29   67-95    789-817 (907)
 44 PLN03086 PRLI-interacting fact  75.0     1.6 3.5E-05   44.0   1.6   28   66-94    449-476 (567)
 45 PHA00732 hypothetical protein   74.3     1.6 3.4E-05   33.1   1.1   22   70-94     27-48  (79)
 46 KOG2482 Predicted C2H2-type Zn  71.1     2.3   5E-05   41.2   1.6   29   70-98    195-225 (423)
 47 COG5189 SFP1 Putative transcri  71.1       2 4.3E-05   41.4   1.2   30   66-95    345-377 (423)
 48 KOG3608 Zn finger proteins [Ge  65.9     3.7   8E-05   40.1   1.8   28   68-95    350-378 (467)
 49 PF12013 DUF3505:  Protein of u  65.1     3.9 8.3E-05   31.7   1.5   27   69-95     79-109 (109)
 50 PRK04860 hypothetical protein;  64.1     2.9 6.3E-05   35.5   0.7   22   63-84    136-157 (160)
 51 PF09986 DUF2225:  Uncharacteri  61.3       2 4.4E-05   37.5  -0.8   25   68-92      3-27  (214)
 52 PF05443 ROS_MUCR:  ROS/MUCR tr  52.3     6.7 0.00015   32.7   0.9   28   68-98     70-97  (132)
 53 PF09845 DUF2072:  Zn-ribbon co  51.2     6.8 0.00015   32.9   0.8   15   70-84      1-15  (131)
 54 COG4957 Predicted transcriptio  49.2       7 0.00015   33.5   0.6   28   70-100    76-103 (148)
 55 smart00154 ZnF_AN1 AN1-like Zi  43.5      11 0.00024   25.0   0.7   15   70-84     12-26  (39)
 56 smart00834 CxxC_CXXC_SSSS Puta  43.2      10 0.00022   24.1   0.5   16   70-85      5-20  (41)
 57 PF13878 zf-C2H2_3:  zinc-finge  43.2      14 0.00031   24.7   1.3   25   70-94     13-39  (41)
 58 smart00734 ZnF_Rad18 Rad18-lik  42.1      16 0.00034   22.4   1.2   20   71-91      2-21  (26)
 59 KOG3408 U1-like Zn-finger-cont  41.0      15 0.00033   30.9   1.3   38   68-108    55-94  (129)
 60 COG5048 FOG: Zn-finger [Genera  38.7      15 0.00032   31.7   1.0   34   63-96     54-89  (467)
 61 PF10276 zf-CHCC:  Zinc-finger   38.2      12 0.00027   25.3   0.3   12   69-80     28-39  (40)
 62 PF02748 PyrI_C:  Aspartate car  36.1      14 0.00031   26.1   0.4   16   67-82     32-47  (52)
 63 TIGR02605 CxxC_CxxC_SSSS putat  35.4      15 0.00033   24.7   0.5   14   70-83      5-18  (52)
 64 KOG1146 Homeobox protein [Gene  34.6      28  0.0006   38.9   2.4   28   65-92    460-487 (1406)
 65 PF01428 zf-AN1:  AN1-like Zinc  33.3      15 0.00032   24.5   0.1   16   69-84     12-27  (43)
 66 PF09723 Zn-ribbon_8:  Zinc rib  33.0      17 0.00038   24.1   0.4   18   70-87      5-22  (42)
 67 PF04959 ARS2:  Arsenite-resist  31.4      19 0.00041   32.3   0.5   31   67-97     74-104 (214)
 68 PLN02748 tRNA dimethylallyltra  30.1      21 0.00046   35.2   0.6   28   69-96    417-447 (468)
 69 KOG1842 FYVE finger-containing  30.0      23  0.0005   35.5   0.8   28   69-96     14-42  (505)
 70 PF13451 zf-trcl:  Probable zin  30.0      22 0.00047   25.3   0.5   15   68-82      2-16  (49)
 71 KOG2785 C2H2-type Zn-finger pr  29.2      25 0.00055   34.3   1.0   26   67-92     65-90  (390)
 72 COG3364 Zn-ribbon containing p  28.9      26 0.00056   28.8   0.8   15   70-84      2-16  (112)
 73 KOG1146 Homeobox protein [Gene  28.0      25 0.00054   39.2   0.8   27   68-95   1327-1353(1406)
 74 PF04780 DUF629:  Protein of un  25.8      47   0.001   33.1   2.2   28   69-96     56-84  (466)
 75 PF04423 Rad50_zn_hook:  Rad50   25.6      25 0.00054   24.2   0.2   11   72-82     22-32  (54)
 76 PF14353 CpXC:  CpXC protein     24.5      18 0.00039   28.6  -0.8   25   69-93     37-61  (128)
 77 COG1773 Rubredoxin [Energy pro  24.1      31 0.00068   25.1   0.5   13   69-81      2-14  (55)
 78 PTZ00448 hypothetical protein;  23.8      42 0.00091   32.7   1.4   23   70-92    314-336 (373)
 79 TIGR00240 ATCase_reg aspartate  23.8      27 0.00059   30.0   0.1   14   70-83    132-145 (150)
 80 cd00924 Cyt_c_Oxidase_Vb Cytoc  23.6      37  0.0008   26.9   0.8   16   65-81     75-90  (97)
 81 PRK00893 aspartate carbamoyltr  23.0      35 0.00076   29.3   0.6   17   67-83    131-147 (152)
 82 PRK00398 rpoP DNA-directed RNA  23.0      37  0.0008   22.7   0.6   18   69-86      2-19  (46)
 83 COG4391 Uncharacterized protei  22.7      38 0.00082   25.4   0.7   14   68-81     46-59  (62)
 84 KOG2636 Splicing factor 3a, su  22.5      53  0.0011   33.0   1.8   25   67-91    398-423 (497)
 85 PF10571 UPF0547:  Uncharacteri  22.4      40 0.00087   20.8   0.6   13   69-81     13-25  (26)
 86 PLN02294 cytochrome c oxidase   21.5      43 0.00094   29.5   0.9   15   68-82    139-153 (174)
 87 PRK00464 nrdR transcriptional   21.5      37  0.0008   28.9   0.4   22   69-90     27-48  (154)
 88 KOG3352 Cytochrome c oxidase,   21.3      45 0.00098   28.8   0.9   14   68-81    131-144 (153)
 89 COG4640 Predicted membrane pro  21.1      54  0.0012   32.6   1.5   23   67-89     12-34  (465)
 90 KOG0717 Molecular chaperone (D  20.8      46   0.001   33.5   1.0   25   71-95    293-319 (508)
 91 COG3677 Transposase and inacti  20.6      39 0.00085   27.7   0.4   16   67-82     50-65  (129)
 92 PLN03238 probable histone acet  20.3      68  0.0015   30.3   1.9   28   68-95     46-73  (290)
 93 KOG2231 Predicted E3 ubiquitin  20.2      45 0.00097   34.7   0.8   25   71-95    100-140 (669)
 94 COG1781 PyrI Aspartate carbamo  20.0      38 0.00083   29.3   0.3   16   70-85    135-150 (153)

No 1  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=98.40  E-value=1.2e-07  Score=86.67  Aligned_cols=37  Identities=22%  Similarity=0.524  Sum_probs=31.9

Q ss_pred             CCCCCCCcceeCCccccccCCchhHHHHhhhcCCcch
Q 045333           62 MGTTWPPRSYTCTFCRREFRSAQALGGHMNVHRRDRA   98 (225)
Q Consensus        62 ~~~~~geKpy~C~~CgK~FsS~qALgGHmr~HtgERp   98 (225)
                      ++||+|||||.|..|+|.|.-+++|.-||++|.+.|+
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~  243 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK  243 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc
Confidence            4788889999999999999999999999999888874


No 2  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=98.36  E-value=1.2e-07  Score=96.84  Aligned_cols=40  Identities=28%  Similarity=0.510  Sum_probs=36.2

Q ss_pred             cCCCCCCCcceeCCccccccCCchhHHHHhhhcCCcchhc
Q 045333           61 IMGTTWPPRSYTCTFCRREFRSAQALGGHMNVHRRDRARL  100 (225)
Q Consensus        61 ~~~~~~geKpy~C~~CgK~FsS~qALgGHmr~HtgERp~~  100 (225)
                      -++||+|||||+|++|||.|..+-+|+-||-+|+..-+..
T Consensus       624 HyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R  663 (958)
T KOG1074|consen  624 HYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPAR  663 (958)
T ss_pred             hhhcccCcCccccccccchhccccchhhcccccccCcccc
Confidence            4689999999999999999999999999999999875543


No 3  
>PHA02768 hypothetical protein; Provisional
Probab=98.09  E-value=1.4e-06  Score=62.81  Aligned_cols=25  Identities=20%  Similarity=0.595  Sum_probs=24.2

Q ss_pred             ceeCCccccccCCchhHHHHhhhcC
Q 045333           70 SYTCTFCRREFRSAQALGGHMNVHR   94 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~Ht   94 (225)
                      .|+|+.|||.|.+.++|.+|||+|+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC
Confidence            5899999999999999999999999


No 4  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.97  E-value=2.8e-06  Score=49.10  Aligned_cols=23  Identities=39%  Similarity=0.853  Sum_probs=22.0

Q ss_pred             eeCCccccccCCchhHHHHhhhc
Q 045333           71 YTCTFCRREFRSAQALGGHMNVH   93 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr~H   93 (225)
                      |+|.+|+|.|.+...|..||+.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            79999999999999999999986


No 5  
>PHA00616 hypothetical protein
Probab=97.94  E-value=2.6e-06  Score=58.95  Aligned_cols=29  Identities=21%  Similarity=0.421  Sum_probs=27.7

Q ss_pred             ceeCCccccccCCchhHHHHhhhcCCcch
Q 045333           70 SYTCTFCRREFRSAQALGGHMNVHRRDRA   98 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~HtgERp   98 (225)
                      ||+|..||+.|..++.|..|++.|+++++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            69999999999999999999999999975


No 6  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=97.91  E-value=3.3e-06  Score=77.32  Aligned_cols=31  Identities=23%  Similarity=0.548  Sum_probs=29.4

Q ss_pred             cceeCCccccccCCchhHHHHhhhcCCcchh
Q 045333           69 RSYTCTFCRREFRSAQALGGHMNVHRRDRAR   99 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHmr~HtgERp~   99 (225)
                      -+++|.+|||.|++..-|.||+|+||||||-
T Consensus       186 l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF  216 (279)
T KOG2462|consen  186 LPCECGICGKAFSRPWLLQGHIRTHTGEKPF  216 (279)
T ss_pred             CCcccccccccccchHHhhcccccccCCCCc
Confidence            5999999999999999999999999999983


No 7  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=97.89  E-value=3.9e-06  Score=85.42  Aligned_cols=36  Identities=22%  Similarity=0.573  Sum_probs=34.2

Q ss_pred             CCCCCcceeCCccccccCCchhHHHHhhhcCCcchh
Q 045333           64 TTWPPRSYTCTFCRREFRSAQALGGHMNVHRRDRAR   99 (225)
Q Consensus        64 ~~~geKpy~C~~CgK~FsS~qALgGHmr~HtgERp~   99 (225)
                      -|+|.|||+|.+|.|.|..+.+|.-|||.|.||||.
T Consensus       916 EHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPf  951 (1007)
T KOG3623|consen  916 EHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPF  951 (1007)
T ss_pred             hhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcc
Confidence            578999999999999999999999999999999984


No 8  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.81  E-value=7.9e-06  Score=48.85  Aligned_cols=26  Identities=31%  Similarity=0.593  Sum_probs=24.4

Q ss_pred             ceeCCccccccCCchhHHHHhhhcCC
Q 045333           70 SYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      +|+|..|++.|.+..+|..||+.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            69999999999999999999999964


No 9  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=97.68  E-value=7.1e-05  Score=77.03  Aligned_cols=38  Identities=21%  Similarity=0.451  Sum_probs=29.5

Q ss_pred             cCCCCCCCcceeCCccccccCCchhHHHHhhhcCCcch
Q 045333           61 IMGTTWPPRSYTCTFCRREFRSAQALGGHMNVHRRDRA   98 (225)
Q Consensus        61 ~~~~~~geKpy~C~~CgK~FsS~qALgGHmr~HtgERp   98 (225)
                      .++.|+|||||+|++||..|+++-+|+-|...|+.+-|
T Consensus       372 HlRSHTGERPfqCnvCG~~FSTkGNLKvH~~rH~e~~p  409 (958)
T KOG1074|consen  372 HLRSHTGERPFQCNVCGNRFSTKGNLKVHFQRHREKYP  409 (958)
T ss_pred             hhhccCCCCCeeecccccccccccceeeeeeeccccCC
Confidence            34677888888888888888888888888888876654


No 10 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.62  E-value=2.7e-05  Score=43.96  Aligned_cols=24  Identities=38%  Similarity=0.888  Sum_probs=20.5

Q ss_pred             eeCCccccccCCchhHHHHhhhcC
Q 045333           71 YTCTFCRREFRSAQALGGHMNVHR   94 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr~Ht   94 (225)
                      |.|.+|++.|.+...|..||+.|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            789999999999999999999873


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=97.58  E-value=8.2e-06  Score=49.62  Aligned_cols=20  Identities=25%  Similarity=0.740  Sum_probs=17.7

Q ss_pred             CCCCCCcceeCCccccccCC
Q 045333           63 GTTWPPRSYTCTFCRREFRS   82 (225)
Q Consensus        63 ~~~~geKpy~C~~CgK~FsS   82 (225)
                      .+|+++|||+|++|+|.|.+
T Consensus         7 ~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    7 RTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHSSSSSEEESSSSEEESS
T ss_pred             hhcCCCCCCCCCCCcCeeCc
Confidence            36889999999999999974


No 12 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.37  E-value=9.8e-05  Score=41.72  Aligned_cols=25  Identities=40%  Similarity=0.784  Sum_probs=23.0

Q ss_pred             eeCCccccccCCchhHHHHhhhcCC
Q 045333           71 YTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      |+|..|++.|.....|..|++.|..
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~~   25 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHXX   25 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhcc
Confidence            6899999999999999999998853


No 13 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=97.33  E-value=6.1e-05  Score=76.97  Aligned_cols=33  Identities=24%  Similarity=0.578  Sum_probs=30.5

Q ss_pred             CCcceeCCccccccCCchhHHHHhhhcCCcchh
Q 045333           67 PPRSYTCTFCRREFRSAQALGGHMNVHRRDRAR   99 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGHmr~HtgERp~   99 (225)
                      .-|.|+|..|||.|.-+.+|+-|.|+|.||||.
T Consensus       278 ~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPf  310 (1007)
T KOG3623|consen  278 LLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPF  310 (1007)
T ss_pred             hhccccccccchhhhhHHHHHhhheeecCCCCc
Confidence            458999999999999999999999999999984


No 14 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.86  E-value=0.00057  Score=49.31  Aligned_cols=34  Identities=18%  Similarity=0.428  Sum_probs=24.6

Q ss_pred             CCCcceeCCccccccCCchhHHHHhhhcCCcchh
Q 045333           66 WPPRSYTCTFCRREFRSAQALGGHMNVHRRDRAR   99 (225)
Q Consensus        66 ~geKpy~C~~CgK~FsS~qALgGHmr~HtgERp~   99 (225)
                      -.+.|..|++|++.+++..+|.+||.++++.||.
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            3578999999999999999999999988888763


No 15 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.85  E-value=0.00038  Score=40.77  Aligned_cols=24  Identities=25%  Similarity=0.758  Sum_probs=22.1

Q ss_pred             eeCCccccccCCchhHHHHhhhcC
Q 045333           71 YTCTFCRREFRSAQALGGHMNVHR   94 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr~Ht   94 (225)
                      |.|++|++.|.+...|..|++.|+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~~   24 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSKK   24 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTHH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcCC
Confidence            789999999999999999998763


No 16 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=96.77  E-value=0.00028  Score=63.60  Aligned_cols=39  Identities=23%  Similarity=0.373  Sum_probs=30.9

Q ss_pred             cCCCCCCCcceeCCccccccCCchhHHHHhhhcCCcchh
Q 045333           61 IMGTTWPPRSYTCTFCRREFRSAQALGGHMNVHRRDRAR   99 (225)
Q Consensus        61 ~~~~~~geKpy~C~~CgK~FsS~qALgGHmr~HtgERp~   99 (225)
                      -+.+|..-|-|-|.+|||.|...-.|++|+|+|+|.||.
T Consensus       136 h~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpy  174 (267)
T KOG3576|consen  136 HLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPY  174 (267)
T ss_pred             HhhhccHHHHHHHhhccCcccchhhhhhhhccccCcccc
Confidence            456777777888888888888888888888888888874


No 17 
>PHA00732 hypothetical protein
Probab=96.40  E-value=0.0017  Score=49.21  Aligned_cols=27  Identities=22%  Similarity=0.352  Sum_probs=24.0

Q ss_pred             ceeCCccccccCCchhHHHHhh-hcCCc
Q 045333           70 SYTCTFCRREFRSAQALGGHMN-VHRRD   96 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr-~HtgE   96 (225)
                      ||+|..|++.|.+..+|..||+ .|++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~~   28 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTLT   28 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCCC
Confidence            6899999999999999999998 47653


No 18 
>PHA00733 hypothetical protein
Probab=95.99  E-value=0.0041  Score=50.58  Aligned_cols=29  Identities=24%  Similarity=0.496  Sum_probs=26.3

Q ss_pred             CCCcceeCCccccccCCchhHHHHhhhcC
Q 045333           66 WPPRSYTCTFCRREFRSAQALGGHMNVHR   94 (225)
Q Consensus        66 ~geKpy~C~~CgK~FsS~qALgGHmr~Ht   94 (225)
                      .++++|.|..|++.|.+...|..|++.|.
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~   97 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYTE   97 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcCC
Confidence            35899999999999999999999999873


No 19 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.68  E-value=0.0033  Score=37.99  Aligned_cols=24  Identities=29%  Similarity=0.638  Sum_probs=21.3

Q ss_pred             ceeCCccccccCCchhHHHHhhhc
Q 045333           70 SYTCTFCRREFRSAQALGGHMNVH   93 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~H   93 (225)
                      .|-|.+|+|.|.+..+|..||+.+
T Consensus         1 q~~C~~C~k~f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    1 QFYCDACDKYFSSENQLKQHMKSK   24 (27)
T ss_dssp             -CBBTTTTBBBSSHHHHHCCTTSH
T ss_pred             CCCcccCCCCcCCHHHHHHHHccC
Confidence            378999999999999999999863


No 20 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=95.63  E-value=0.0041  Score=56.22  Aligned_cols=37  Identities=22%  Similarity=0.429  Sum_probs=31.7

Q ss_pred             cCcCCCCCCCcceeCCccccccCCchhHHHHhhhcCC
Q 045333           59 GNIMGTTWPPRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        59 ~~~~~~~~geKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      ..-+.||+|-|||+|..|+|.|..+-.|..|.+.-.|
T Consensus       162 krh~rthtgvrpykc~~c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  162 KRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             hhhhccccCccccchhhhhHHHHhhccHHHHHHHHcC
Confidence            3456899999999999999999999999999764333


No 21 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.92  E-value=0.015  Score=42.19  Aligned_cols=25  Identities=40%  Similarity=0.911  Sum_probs=22.2

Q ss_pred             cceeCCccccccCCchhHHHHhhhc
Q 045333           69 RSYTCTFCRREFRSAQALGGHMNVH   93 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHmr~H   93 (225)
                      +.+.|.+|++.|.+..+|..||+.+
T Consensus        49 ~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   49 ESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCCccCCCCcCHHHHHHHHcCc
Confidence            3799999999999999999999975


No 22 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=94.53  E-value=0.017  Score=33.65  Aligned_cols=23  Identities=26%  Similarity=0.613  Sum_probs=19.0

Q ss_pred             eeCCccccccCCchhHHHHhhhcC
Q 045333           71 YTCTFCRREFRSAQALGGHMNVHR   94 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr~Ht   94 (225)
                      |+|+.|.-... ...|..|++.|.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            79999999998 999999999864


No 23 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.01  E-value=0.029  Score=34.11  Aligned_cols=21  Identities=29%  Similarity=0.738  Sum_probs=18.7

Q ss_pred             eeCCccccccCCchhHHHHhhh
Q 045333           71 YTCTFCRREFRSAQALGGHMNV   92 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr~   92 (225)
                      ..|.+|||.| ...+|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4799999999 88999999875


No 24 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.78  E-value=0.036  Score=34.35  Aligned_cols=23  Identities=17%  Similarity=0.598  Sum_probs=21.1

Q ss_pred             ceeCCccccccCCchhHHHHhhh
Q 045333           70 SYTCTFCRREFRSAQALGGHMNV   92 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~   92 (225)
                      +|.|.+|++.|.+..++..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            68999999999999999999864


No 25 
>PHA00733 hypothetical protein
Probab=92.99  E-value=0.06  Score=43.80  Aligned_cols=28  Identities=25%  Similarity=0.523  Sum_probs=24.3

Q ss_pred             CcceeCCccccccCCchhHHHHhhhcCC
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      +++|+|.+|+|.|....+|..|++-..+
T Consensus        97 ~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         97 EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            4689999999999999999999976543


No 26 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=92.69  E-value=0.06  Score=32.56  Aligned_cols=15  Identities=27%  Similarity=0.468  Sum_probs=13.3

Q ss_pred             hHHHHhhhcCCcchh
Q 045333           85 ALGGHMNVHRRDRAR   99 (225)
Q Consensus        85 ALgGHmr~HtgERp~   99 (225)
                      +|..||++|+++||.
T Consensus         1 ~l~~H~~~H~~~k~~   15 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPY   15 (26)
T ss_dssp             HHHHHHHHHSSSSSE
T ss_pred             CHHHHhhhcCCCCCC
Confidence            589999999999973


No 27 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=92.13  E-value=0.065  Score=52.55  Aligned_cols=26  Identities=27%  Similarity=0.627  Sum_probs=24.8

Q ss_pred             ceeCCccccccCCchhHHHHhhhcCC
Q 045333           70 SYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      .|+|..|+|.|...-+|-.|.|.|+-
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKP  320 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKP  320 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCC
Confidence            79999999999999999999999964


No 28 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=91.42  E-value=0.037  Score=51.30  Aligned_cols=36  Identities=25%  Similarity=0.564  Sum_probs=29.9

Q ss_pred             CcCCCCCCCcceeCCccccccCCchhHHHH-hhhcCC
Q 045333           60 NIMGTTWPPRSYTCTFCRREFRSAQALGGH-MNVHRR   95 (225)
Q Consensus        60 ~~~~~~~geKpy~C~~CgK~FsS~qALgGH-mr~Htg   95 (225)
                      .|+--|-..|-|+|.+|.|+..+..-|..| |++|+.
T Consensus        24 kiliqhqkakhfkchichkkl~sgpglsihcmqvhke   60 (341)
T KOG2893|consen   24 KILIQHQKAKHFKCHICHKKLFSGPGLSIHCMQVHKE   60 (341)
T ss_pred             hhhhhhhhhccceeeeehhhhccCCCceeehhhhhhh
Confidence            444456678999999999999999999999 778864


No 29 
>PHA02768 hypothetical protein; Provisional
Probab=89.95  E-value=0.092  Score=37.99  Aligned_cols=24  Identities=8%  Similarity=0.027  Sum_probs=19.8

Q ss_pred             CCCCCCCcceeCCccccccCCchhHH
Q 045333           62 MGTTWPPRSYTCTFCRREFRSAQALG   87 (225)
Q Consensus        62 ~~~~~geKpy~C~~CgK~FsS~qALg   87 (225)
                      +.+|+  |+|+|..|+|.|...+.|-
T Consensus        25 ~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768         25 LRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             HHhcC--CcccCCcccceecccceeE
Confidence            45676  7999999999999887763


No 30 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=88.05  E-value=0.26  Score=47.87  Aligned_cols=37  Identities=19%  Similarity=0.371  Sum_probs=31.6

Q ss_pred             cCcCCCCCCCcceeCCccccccCCchhHHHHhhhcCC
Q 045333           59 GNIMGTTWPPRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        59 ~~~~~~~~geKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      ..++-.|...|||+|+.|++.|.+-..|.+|..+|+.
T Consensus       281 ~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~  317 (467)
T KOG3608|consen  281 THIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSK  317 (467)
T ss_pred             HHHHhhhccCCCccccchhhhhccHHHHHHHHHhccc
Confidence            3455567789999999999999999999999999984


No 31 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=87.11  E-value=0.24  Score=48.74  Aligned_cols=29  Identities=28%  Similarity=0.610  Sum_probs=25.3

Q ss_pred             CCcceeCCccccccCCchhHHHHhhhcCC
Q 045333           67 PPRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      .+-.|.|.+|+|+|++.-.|++|+-+|..
T Consensus       353 s~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  353 SSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             cCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence            34599999999999999999999877753


No 32 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=85.80  E-value=0.53  Score=30.86  Aligned_cols=27  Identities=19%  Similarity=0.568  Sum_probs=17.7

Q ss_pred             CCcceeCCccccccCCc----hhHHHHh-hhc
Q 045333           67 PPRSYTCTFCRREFRSA----QALGGHM-NVH   93 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~----qALgGHm-r~H   93 (225)
                      +.+..+|++|++.|...    ..|..|+ +.|
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            35678999999999985    7888898 444


No 33 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=85.72  E-value=0.54  Score=32.48  Aligned_cols=27  Identities=37%  Similarity=0.835  Sum_probs=20.6

Q ss_pred             ceeCCccccccCCchhHHHHh-hhcCCcc
Q 045333           70 SYTCTFCRREFRSAQALGGHM-NVHRRDR   97 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHm-r~HtgER   97 (225)
                      .|.|++|++.| +...|..|. ..|..++
T Consensus         2 ~f~CP~C~~~~-~~~~L~~H~~~~H~~~~   29 (54)
T PF05605_consen    2 SFTCPYCGKGF-SESSLVEHCEDEHRSES   29 (54)
T ss_pred             CcCCCCCCCcc-CHHHHHHHHHhHCcCCC
Confidence            58999999955 568899996 5666553


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=83.99  E-value=0.34  Score=46.49  Aligned_cols=24  Identities=21%  Similarity=0.654  Sum_probs=21.7

Q ss_pred             CCcceeCCccccccCCchhHHHHh
Q 045333           67 PPRSYTCTFCRREFRSAQALGGHM   90 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGHm   90 (225)
                      ..|||+|.+|+|.+..-.-|+-|.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCCceeccccchhhccCccceecc
Confidence            469999999999999999998885


No 35 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=83.90  E-value=0.64  Score=31.71  Aligned_cols=25  Identities=20%  Similarity=0.612  Sum_probs=20.5

Q ss_pred             ceeCCccccccCCc-----hhHHHHhh-hcC
Q 045333           70 SYTCTFCRREFRSA-----QALGGHMN-VHR   94 (225)
Q Consensus        70 py~C~~CgK~FsS~-----qALgGHmr-~Ht   94 (225)
                      .=.|++|++.++..     .+|..|++ .|.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            45899999999876     58999988 564


No 36 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=83.24  E-value=0.75  Score=31.77  Aligned_cols=26  Identities=23%  Similarity=0.561  Sum_probs=21.0

Q ss_pred             CcceeCCccccccCCchhHHHHhhhcCC
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      .+.+.|++|.+.+..  .|..||+.+.+
T Consensus        29 ~~~v~CPiC~~~~~~--~l~~Hl~~~H~   54 (54)
T PF05605_consen   29 SKNVVCPICSSRVTD--NLIRHLNSQHR   54 (54)
T ss_pred             CCCccCCCchhhhhh--HHHHHHHHhcC
Confidence            357999999997664  99999987653


No 37 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=82.34  E-value=0.81  Score=46.09  Aligned_cols=28  Identities=14%  Similarity=0.247  Sum_probs=21.2

Q ss_pred             cceeCCccccccCCchhHHHHhhhcCCcch
Q 045333           69 RSYTCTFCRREFRSAQALGGHMNVHRRDRA   98 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHmr~HtgERp   98 (225)
                      ++|.|+ |++.| .+..|..|++.|..+|+
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp  504 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRL  504 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCc
Confidence            678888 88655 55788888888887776


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=82.18  E-value=0.76  Score=39.08  Aligned_cols=27  Identities=22%  Similarity=0.468  Sum_probs=23.7

Q ss_pred             cceeCCccccccCCchhHHHHhhhcCCcchh
Q 045333           69 RSYTCTFCRREFRSAQALGGHMNVHRRDRAR   99 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHmr~HtgERp~   99 (225)
                      -+|.|. |++   ....+..|+++|+++++.
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~Y  144 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVY  144 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccE
Confidence            379998 998   888899999999999863


No 39 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=81.51  E-value=0.46  Score=34.28  Aligned_cols=24  Identities=33%  Similarity=0.652  Sum_probs=0.0

Q ss_pred             eCCccccccCCchhHHHHhhhcCC
Q 045333           72 TCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        72 ~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      +|.+|+..|.+...|..||+...+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~   24 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHG   24 (100)
T ss_dssp             ------------------------
T ss_pred             Cccccccccccccccccccccccc
Confidence            599999999999999999965444


No 40 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=80.00  E-value=0.71  Score=39.77  Aligned_cols=36  Identities=19%  Similarity=0.451  Sum_probs=30.2

Q ss_pred             CCCCC--cceeCC--ccccccCCchhHHHHhhhcCCcchh
Q 045333           64 TTWPP--RSYTCT--FCRREFRSAQALGGHMNVHRRDRAR   99 (225)
Q Consensus        64 ~~~ge--Kpy~C~--~CgK~FsS~qALgGHmr~HtgERp~   99 (225)
                      .|.++  ++|.|.  +|++.|.+..+|..|...|.+.++.
T Consensus       313 ~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         313 NHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             ccccccCCceeeeccCCCccccccccccCCcccccCCCcc
Confidence            57778  899999  7999999999999999988887654


No 41 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=76.60  E-value=1  Score=33.52  Aligned_cols=27  Identities=22%  Similarity=0.270  Sum_probs=24.5

Q ss_pred             CCCcceeCCccccccCCchhHHHHhhh
Q 045333           66 WPPRSYTCTFCRREFRSAQALGGHMNV   92 (225)
Q Consensus        66 ~geKpy~C~~CgK~FsS~qALgGHmr~   92 (225)
                      .||--++|+-|++.|+......+|.+.
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            477889999999999999999999874


No 42 
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=75.97  E-value=1.3  Score=44.72  Aligned_cols=32  Identities=19%  Similarity=0.396  Sum_probs=27.9

Q ss_pred             CCcceeCCccccccCCchhHHHHhhhcCCcch
Q 045333           67 PPRSYTCTFCRREFRSAQALGGHMNVHRRDRA   98 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGHmr~HtgERp   98 (225)
                      ..++.+|+.||+.|....-...||..|-..+-
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~dwh~  446 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDDWHR  446 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhhhhh
Confidence            46889999999999999999999998876544


No 43 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=75.69  E-value=0.72  Score=48.15  Aligned_cols=29  Identities=28%  Similarity=0.650  Sum_probs=26.2

Q ss_pred             CCcceeCCccccccCCchhHHHHhhhcCC
Q 045333           67 PPRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      ..--|-|..|+|.|..-..++-||+.|+-
T Consensus       789 ~~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  789 PTGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CCceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            34579999999999999999999999974


No 44 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=75.00  E-value=1.6  Score=44.00  Aligned_cols=28  Identities=21%  Similarity=0.446  Sum_probs=23.6

Q ss_pred             CCCcceeCCccccccCCchhHHHHhhhcC
Q 045333           66 WPPRSYTCTFCRREFRSAQALGGHMNVHR   94 (225)
Q Consensus        66 ~geKpy~C~~CgK~FsS~qALgGHmr~Ht   94 (225)
                      ..++.+.|++|++.|. ...|..|+++|+
T Consensus       449 el~~H~~C~~Cgk~f~-~s~LekH~~~~H  476 (567)
T PLN03086        449 EAKNHVHCEKCGQAFQ-QGEMEKHMKVFH  476 (567)
T ss_pred             ccccCccCCCCCCccc-hHHHHHHHHhcC
Confidence            3467889999999996 678999999875


No 45 
>PHA00732 hypothetical protein
Probab=74.33  E-value=1.6  Score=33.13  Aligned_cols=22  Identities=23%  Similarity=0.602  Sum_probs=17.5

Q ss_pred             ceeCCccccccCCchhHHHHhhhcC
Q 045333           70 SYTCTFCRREFRSAQALGGHMNVHR   94 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~Ht   94 (225)
                      +++|+.|+|.|.   .|..|++.+.
T Consensus        27 ~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732         27 LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CCccCCCCCEeC---ChhhhhcccC
Confidence            568999999998   4888886543


No 46 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=71.14  E-value=2.3  Score=41.24  Aligned_cols=29  Identities=34%  Similarity=0.722  Sum_probs=24.6

Q ss_pred             ceeCCccccccCCchhHHHHhh--hcCCcch
Q 045333           70 SYTCTFCRREFRSAQALGGHMN--VHRRDRA   98 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr--~HtgERp   98 (225)
                      .++|-+|.|.|+.+..|.-|||  .|++-.|
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinP  225 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINP  225 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCC
Confidence            5899999999999999999997  5655444


No 47 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=71.11  E-value=2  Score=41.45  Aligned_cols=30  Identities=23%  Similarity=0.589  Sum_probs=25.0

Q ss_pred             CCCcceeCCc--cccccCCchhHHHHhh-hcCC
Q 045333           66 WPPRSYTCTF--CRREFRSAQALGGHMN-VHRR   95 (225)
Q Consensus        66 ~geKpy~C~~--CgK~FsS~qALgGHmr-~Htg   95 (225)
                      .++|||+|++  |.|++....-|+-||. .|..
T Consensus       345 ~d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~  377 (423)
T COG5189         345 KDGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQN  377 (423)
T ss_pred             ecCceecCCCCCchhhhccccchhhhhhccccC
Confidence            3469999998  9999999999999985 4433


No 48 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=65.89  E-value=3.7  Score=40.15  Aligned_cols=28  Identities=36%  Similarity=0.686  Sum_probs=23.5

Q ss_pred             CcceeCCccccccCCchhHHHHhh-hcCC
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMN-VHRR   95 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr-~Htg   95 (225)
                      +-+|+|..|+|.|.++.+|+.|.+ .|.-
T Consensus       350 p~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  350 PILYACHCCDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             CCceeeecchhhhccchhHHHHHHHhhcc
Confidence            568999999999999999999964 4543


No 49 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=65.14  E-value=3.9  Score=31.66  Aligned_cols=27  Identities=22%  Similarity=0.444  Sum_probs=24.4

Q ss_pred             cceeC----CccccccCCchhHHHHhhhcCC
Q 045333           69 RSYTC----TFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        69 Kpy~C----~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      .-|.|    ..|+..+++...|..|++.+.|
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            46999    9999999999999999998764


No 50 
>PRK04860 hypothetical protein; Provisional
Probab=64.12  E-value=2.9  Score=35.55  Aligned_cols=22  Identities=14%  Similarity=0.244  Sum_probs=18.0

Q ss_pred             CCCCCCcceeCCccccccCCch
Q 045333           63 GTTWPPRSYTCTFCRREFRSAQ   84 (225)
Q Consensus        63 ~~~~geKpy~C~~CgK~FsS~q   84 (225)
                      .+|.++++|.|..|++.|.-..
T Consensus       136 ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        136 RVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             HHhcCCccEECCCCCceeEEec
Confidence            4567899999999999997543


No 51 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=61.28  E-value=2  Score=37.54  Aligned_cols=25  Identities=28%  Similarity=0.752  Sum_probs=21.5

Q ss_pred             CcceeCCccccccCCchhHHHHhhh
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMNV   92 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr~   92 (225)
                      +|.++|++|++.|.++.-+.+..|+
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~   27 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRV   27 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceE
Confidence            5789999999999998888777665


No 52 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=52.35  E-value=6.7  Score=32.69  Aligned_cols=28  Identities=25%  Similarity=0.580  Sum_probs=18.5

Q ss_pred             CcceeCCccccccCCchhHHHHhhhcCCcch
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMNVHRRDRA   98 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr~HtgERp   98 (225)
                      +..-.|-+|||.|..   |++|.+.|+|-.|
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCCH
Confidence            456799999999975   6999999988765


No 53 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=51.16  E-value=6.8  Score=32.93  Aligned_cols=15  Identities=33%  Similarity=0.685  Sum_probs=13.7

Q ss_pred             ceeCCccccccCCch
Q 045333           70 SYTCTFCRREFRSAQ   84 (225)
Q Consensus        70 py~C~~CgK~FsS~q   84 (225)
                      ||+|.-||+.|....
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            799999999999876


No 54 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=49.24  E-value=7  Score=33.46  Aligned_cols=28  Identities=21%  Similarity=0.265  Sum_probs=23.3

Q ss_pred             ceeCCccccccCCchhHHHHhhhcCCcchhc
Q 045333           70 SYTCTFCRREFRSAQALGGHMNVHRRDRARL  100 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~HtgERp~~  100 (225)
                      ---|-.|||.|.+   |++|.++|.+--|..
T Consensus        76 ~IicLEDGkkfKS---LKRHL~t~~gmTPd~  103 (148)
T COG4957          76 YIICLEDGKKFKS---LKRHLTTHYGLTPDE  103 (148)
T ss_pred             eEEEeccCcchHH---HHHHHhcccCCCHHH
Confidence            4579999999975   999999999876643


No 55 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=43.53  E-value=11  Score=25.01  Aligned_cols=15  Identities=20%  Similarity=0.693  Sum_probs=13.0

Q ss_pred             ceeCCccccccCCch
Q 045333           70 SYTCTFCRREFRSAQ   84 (225)
Q Consensus        70 py~C~~CgK~FsS~q   84 (225)
                      +|+|..|++.|-...
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            899999999997653


No 56 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=43.24  E-value=10  Score=24.06  Aligned_cols=16  Identities=31%  Similarity=0.692  Sum_probs=12.6

Q ss_pred             ceeCCccccccCCchh
Q 045333           70 SYTCTFCRREFRSAQA   85 (225)
Q Consensus        70 py~C~~CgK~FsS~qA   85 (225)
                      .|+|..||+.|.--+.
T Consensus         5 ~y~C~~Cg~~fe~~~~   20 (41)
T smart00834        5 EYRCEDCGHTFEVLQK   20 (41)
T ss_pred             EEEcCCCCCEEEEEEe
Confidence            5899999999975443


No 57 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=43.19  E-value=14  Score=24.66  Aligned_cols=25  Identities=20%  Similarity=0.348  Sum_probs=19.2

Q ss_pred             ceeCCccccccCCc--hhHHHHhhhcC
Q 045333           70 SYTCTFCRREFRSA--QALGGHMNVHR   94 (225)
Q Consensus        70 py~C~~CgK~FsS~--qALgGHmr~Ht   94 (225)
                      .-+|+.||..|...  ..-.-|.+.|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            35999999999874  45567887775


No 58 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=42.09  E-value=16  Score=22.36  Aligned_cols=20  Identities=25%  Similarity=0.697  Sum_probs=16.1

Q ss_pred             eeCCccccccCCchhHHHHhh
Q 045333           71 YTCTFCRREFRSAQALGGHMN   91 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr   91 (225)
                      ..|++|++.+ ....+..|..
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3699999999 6678888865


No 59 
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=40.98  E-value=15  Score=30.87  Aligned_cols=38  Identities=32%  Similarity=0.569  Sum_probs=28.1

Q ss_pred             CcceeCCccccccCCchhHHHHhh--hcCCcchhcccccCCCC
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMN--VHRRDRARLHHHQAQPH  108 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr--~HtgERp~~~~~~~~p~  108 (225)
                      --.|-|=.|.|-|....+|.-|.+  .|+   .+++.....|.
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~ktK~HK---rRvK~l~~~Py   94 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKTKVHK---RRVKELREVPY   94 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhccHHH---HHHHhcccCCc
Confidence            348999999999999999999997  453   34444444444


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=38.70  E-value=15  Score=31.69  Aligned_cols=34  Identities=18%  Similarity=0.539  Sum_probs=18.7

Q ss_pred             CCCCCCcceeCCc--cccccCCchhHHHHhhhcCCc
Q 045333           63 GTTWPPRSYTCTF--CRREFRSAQALGGHMNVHRRD   96 (225)
Q Consensus        63 ~~~~geKpy~C~~--CgK~FsS~qALgGHmr~HtgE   96 (225)
                      ..+.+++++.|..  |.+.|.....+..|.+.|...
T Consensus        54 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (467)
T COG5048          54 RSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHNN   89 (467)
T ss_pred             ccccccCCccccccccccccCCcchhhhhccccccc
Confidence            4455566666655  445555555555555555543


No 61 
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=38.25  E-value=12  Score=25.34  Aligned_cols=12  Identities=17%  Similarity=0.855  Sum_probs=10.8

Q ss_pred             cceeCCcccccc
Q 045333           69 RSYTCTFCRREF   80 (225)
Q Consensus        69 Kpy~C~~CgK~F   80 (225)
                      ++-.|++|++.|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            578999999988


No 62 
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=36.12  E-value=14  Score=26.11  Aligned_cols=16  Identities=25%  Similarity=0.746  Sum_probs=11.3

Q ss_pred             CCcceeCCccccccCC
Q 045333           67 PPRSYTCTFCRREFRS   82 (225)
Q Consensus        67 geKpy~C~~CgK~FsS   82 (225)
                      ....|+|.||++.|..
T Consensus        32 ~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   32 EPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTCEEEETTT--EEEH
T ss_pred             CCCEEEeeCCCCEecc
Confidence            4578999999998864


No 63 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=35.35  E-value=15  Score=24.67  Aligned_cols=14  Identities=36%  Similarity=0.861  Sum_probs=11.9

Q ss_pred             ceeCCccccccCCc
Q 045333           70 SYTCTFCRREFRSA   83 (225)
Q Consensus        70 py~C~~CgK~FsS~   83 (225)
                      .|+|..||..|..-
T Consensus         5 ey~C~~Cg~~fe~~   18 (52)
T TIGR02605         5 EYRCTACGHRFEVL   18 (52)
T ss_pred             EEEeCCCCCEeEEE
Confidence            58999999999854


No 64 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=34.64  E-value=28  Score=38.91  Aligned_cols=28  Identities=29%  Similarity=0.481  Sum_probs=25.4

Q ss_pred             CCCCcceeCCccccccCCchhHHHHhhh
Q 045333           65 TWPPRSYTCTFCRREFRSAQALGGHMNV   92 (225)
Q Consensus        65 ~~geKpy~C~~CgK~FsS~qALgGHmr~   92 (225)
                      ++-.|-|+|..|+..|+..+.|+.|||.
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRs  487 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRS  487 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccc
Confidence            3445999999999999999999999997


No 65 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=33.34  E-value=15  Score=24.45  Aligned_cols=16  Identities=19%  Similarity=0.663  Sum_probs=10.6

Q ss_pred             cceeCCccccccCCch
Q 045333           69 RSYTCTFCRREFRSAQ   84 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~q   84 (225)
                      -+|+|+.|++.|=...
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            4899999999997643


No 66 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=33.04  E-value=17  Score=24.14  Aligned_cols=18  Identities=33%  Similarity=0.781  Sum_probs=13.8

Q ss_pred             ceeCCccccccCCchhHH
Q 045333           70 SYTCTFCRREFRSAQALG   87 (225)
Q Consensus        70 py~C~~CgK~FsS~qALg   87 (225)
                      .|+|..||..|-.-+.+.
T Consensus         5 ey~C~~Cg~~fe~~~~~~   22 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSIS   22 (42)
T ss_pred             EEEeCCCCCEEEEEEEcC
Confidence            589999999997655443


No 67 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=31.43  E-value=19  Score=32.25  Aligned_cols=31  Identities=13%  Similarity=0.484  Sum_probs=22.4

Q ss_pred             CCcceeCCccccccCCchhHHHHhhhcCCcc
Q 045333           67 PPRSYTCTFCRREFRSAQALGGHMNVHRRDR   97 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGHmr~HtgER   97 (225)
                      .+..|.|..|+|.|.-..=-.+|...=+.|+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            5668999999999999999999975444443


No 68 
>PLN02748 tRNA dimethylallyltransferase
Probab=30.12  E-value=21  Score=35.24  Aligned_cols=28  Identities=29%  Similarity=0.580  Sum_probs=22.2

Q ss_pred             cceeCCcccc-ccCCchhHHHHh--hhcCCc
Q 045333           69 RSYTCTFCRR-EFRSAQALGGHM--NVHRRD   96 (225)
Q Consensus        69 Kpy~C~~CgK-~FsS~qALgGHm--r~HtgE   96 (225)
                      +.|.|.+|++ .|..-..-..|+  |.|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr~Hk~~  447 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGRGHRKR  447 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcchHHHHH
Confidence            7899999997 799888888887  456543


No 69 
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=30.01  E-value=23  Score=35.52  Aligned_cols=28  Identities=21%  Similarity=0.542  Sum_probs=24.6

Q ss_pred             cceeCCccccccCCchhHHHHh-hhcCCc
Q 045333           69 RSYTCTFCRREFRSAQALGGHM-NVHRRD   96 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHm-r~HtgE   96 (225)
                      +-|.|++|.+.|.+-++|.-|. +-|-+|
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            5799999999999999999998 567655


No 70 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=29.98  E-value=22  Score=25.30  Aligned_cols=15  Identities=33%  Similarity=0.640  Sum_probs=12.6

Q ss_pred             CcceeCCccccccCC
Q 045333           68 PRSYTCTFCRREFRS   82 (225)
Q Consensus        68 eKpy~C~~CgK~FsS   82 (225)
                      +|.+.|.-||+.|.=
T Consensus         2 Dk~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVF   16 (49)
T ss_pred             CeeEEcccCCCeEEE
Confidence            578999999999853


No 71 
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=29.25  E-value=25  Score=34.33  Aligned_cols=26  Identities=23%  Similarity=0.494  Sum_probs=23.2

Q ss_pred             CCcceeCCccccccCCchhHHHHhhh
Q 045333           67 PPRSYTCTFCRREFRSAQALGGHMNV   92 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGHmr~   92 (225)
                      ++-++.|.+|.|.|.+..|...|+..
T Consensus        65 ~~~~~~c~~c~k~~~s~~a~~~hl~S   90 (390)
T KOG2785|consen   65 AESVVYCEACNKSFASPKAHENHLKS   90 (390)
T ss_pred             cccceehHHhhccccChhhHHHHHHH
Confidence            45689999999999999999999853


No 72 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=28.87  E-value=26  Score=28.85  Aligned_cols=15  Identities=27%  Similarity=0.576  Sum_probs=13.4

Q ss_pred             ceeCCccccccCCch
Q 045333           70 SYTCTFCRREFRSAQ   84 (225)
Q Consensus        70 py~C~~CgK~FsS~q   84 (225)
                      ||+|.-||+.|...+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            799999999999853


No 73 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=28.01  E-value=25  Score=39.22  Aligned_cols=27  Identities=22%  Similarity=0.263  Sum_probs=22.8

Q ss_pred             CcceeCCccccccCCchhHHHHhhhcCC
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      -++| |.+|...|+..++|..|||.-..
T Consensus      1327 ~~~~-c~~c~~~~~~~~alqihm~~~~~ 1353 (1406)
T KOG1146|consen 1327 CTYH-CLACEVLLSGREALQIHMRSSAH 1353 (1406)
T ss_pred             cccc-chHHHhhcchhHHHHHHHHHhhh
Confidence            3566 99999999999999999985433


No 74 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=25.79  E-value=47  Score=33.11  Aligned_cols=28  Identities=29%  Similarity=0.595  Sum_probs=24.3

Q ss_pred             cceeCCccccccCCchhHHHHhh-hcCCc
Q 045333           69 RSYTCTFCRREFRSAQALGGHMN-VHRRD   96 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHmr-~HtgE   96 (225)
                      |--.|.+|.+.|.....+..||. -|-+.
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            56789999999999999999995 67654


No 75 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=25.55  E-value=25  Score=24.20  Aligned_cols=11  Identities=27%  Similarity=0.899  Sum_probs=6.5

Q ss_pred             eCCccccccCC
Q 045333           72 TCTFCRREFRS   82 (225)
Q Consensus        72 ~C~~CgK~FsS   82 (225)
                      .|++|+|.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            99999999986


No 76 
>PF14353 CpXC:  CpXC protein
Probab=24.52  E-value=18  Score=28.56  Aligned_cols=25  Identities=32%  Similarity=0.432  Sum_probs=19.6

Q ss_pred             cceeCCccccccCCchhHHHHhhhc
Q 045333           69 RSYTCTFCRREFRSAQALGGHMNVH   93 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHmr~H   93 (225)
                      -.|.|+.||+.|.-...+--|-..|
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~~~   61 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDPEK   61 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcCCC
Confidence            4799999999998877776665543


No 77 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=24.15  E-value=31  Score=25.09  Aligned_cols=13  Identities=15%  Similarity=0.797  Sum_probs=11.1

Q ss_pred             cceeCCccccccC
Q 045333           69 RSYTCTFCRREFR   81 (225)
Q Consensus        69 Kpy~C~~CgK~Fs   81 (225)
                      +.|+|+.||..|.
T Consensus         2 ~~~~C~~CG~vYd   14 (55)
T COG1773           2 KRWRCSVCGYVYD   14 (55)
T ss_pred             CceEecCCceEec
Confidence            4689999999985


No 78 
>PTZ00448 hypothetical protein; Provisional
Probab=23.84  E-value=42  Score=32.68  Aligned_cols=23  Identities=17%  Similarity=0.356  Sum_probs=21.1

Q ss_pred             ceeCCccccccCCchhHHHHhhh
Q 045333           70 SYTCTFCRREFRSAQALGGHMNV   92 (225)
Q Consensus        70 py~C~~CgK~FsS~qALgGHmr~   92 (225)
                      .|.|..|+-.|.+......|++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            68899999999999999999983


No 79 
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=23.79  E-value=27  Score=29.97  Aligned_cols=14  Identities=21%  Similarity=0.826  Sum_probs=11.9

Q ss_pred             ceeCCccccccCCc
Q 045333           70 SYTCTFCRREFRSA   83 (225)
Q Consensus        70 py~C~~CgK~FsS~   83 (225)
                      .|+|.||++.|...
T Consensus       132 ~lrC~YCe~~~~~~  145 (150)
T TIGR00240       132 ALRCYYCEKEIEHN  145 (150)
T ss_pred             EEEEECCCCEEecc
Confidence            59999999999643


No 80 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=23.62  E-value=37  Score=26.95  Aligned_cols=16  Identities=19%  Similarity=0.464  Sum_probs=13.2

Q ss_pred             CCCCcceeCCccccccC
Q 045333           65 TWPPRSYTCTFCRREFR   81 (225)
Q Consensus        65 ~~geKpy~C~~CgK~Fs   81 (225)
                      +.+ ++++|..||.-|.
T Consensus        75 ~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          75 EKG-KPKRCPECGHVFK   90 (97)
T ss_pred             eCC-CceeCCCCCcEEE
Confidence            344 7999999999885


No 81 
>PRK00893 aspartate carbamoyltransferase regulatory subunit; Reviewed
Probab=23.00  E-value=35  Score=29.30  Aligned_cols=17  Identities=29%  Similarity=0.905  Sum_probs=13.7

Q ss_pred             CCcceeCCccccccCCc
Q 045333           67 PPRSYTCTFCRREFRSA   83 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~   83 (225)
                      ....|+|.||++.|...
T Consensus       131 ~~~~~rC~YCe~~~~~~  147 (152)
T PRK00893        131 EPIKLRCKYCEKEFSED  147 (152)
T ss_pred             CCCEEEeeCCCCEechh
Confidence            34579999999999753


No 82 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=22.98  E-value=37  Score=22.65  Aligned_cols=18  Identities=28%  Similarity=0.527  Sum_probs=13.2

Q ss_pred             cceeCCccccccCCchhH
Q 045333           69 RSYTCTFCRREFRSAQAL   86 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qAL   86 (225)
                      ..|+|..||..|.-...-
T Consensus         2 ~~y~C~~CG~~~~~~~~~   19 (46)
T PRK00398          2 AEYKCARCGREVELDEYG   19 (46)
T ss_pred             CEEECCCCCCEEEECCCC
Confidence            468999999988664443


No 83 
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.71  E-value=38  Score=25.35  Aligned_cols=14  Identities=21%  Similarity=0.847  Sum_probs=11.7

Q ss_pred             CcceeCCccccccC
Q 045333           68 PRSYTCTFCRREFR   81 (225)
Q Consensus        68 eKpy~C~~CgK~Fs   81 (225)
                      +..-.|++|++.|+
T Consensus        46 ~gev~CPYC~t~y~   59 (62)
T COG4391          46 EGEVVCPYCSTRYR   59 (62)
T ss_pred             CCcEecCccccEEE
Confidence            45679999999986


No 84 
>KOG2636 consensus Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=22.48  E-value=53  Score=33.04  Aligned_cols=25  Identities=24%  Similarity=0.618  Sum_probs=22.0

Q ss_pred             CCcceeCCccc-cccCCchhHHHHhh
Q 045333           67 PPRSYTCTFCR-REFRSAQALGGHMN   91 (225)
Q Consensus        67 geKpy~C~~Cg-K~FsS~qALgGHmr   91 (225)
                      =.+.|.|.||| +++.-..|+.+|..
T Consensus       398 L~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  398 LDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             CCcccceeeccCccccCcHHHHHHhH
Confidence            35789999999 99999999999964


No 85 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=22.35  E-value=40  Score=20.79  Aligned_cols=13  Identities=23%  Similarity=0.690  Sum_probs=10.4

Q ss_pred             cceeCCccccccC
Q 045333           69 RSYTCTFCRREFR   81 (225)
Q Consensus        69 Kpy~C~~CgK~Fs   81 (225)
                      ..-.|+.||..|.
T Consensus        13 ~~~~Cp~CG~~F~   25 (26)
T PF10571_consen   13 SAKFCPHCGYDFE   25 (26)
T ss_pred             hcCcCCCCCCCCc
Confidence            3458999999995


No 86 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=21.53  E-value=43  Score=29.49  Aligned_cols=15  Identities=27%  Similarity=0.786  Sum_probs=12.8

Q ss_pred             CcceeCCccccccCC
Q 045333           68 PRSYTCTFCRREFRS   82 (225)
Q Consensus        68 eKpy~C~~CgK~FsS   82 (225)
                      .|+++|..||..|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            379999999999863


No 87 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=21.49  E-value=37  Score=28.88  Aligned_cols=22  Identities=18%  Similarity=0.356  Sum_probs=17.9

Q ss_pred             cceeCCccccccCCchhHHHHh
Q 045333           69 RSYTCTFCRREFRSAQALGGHM   90 (225)
Q Consensus        69 Kpy~C~~CgK~FsS~qALgGHm   90 (225)
                      |-|+|.-||+.|.....+..=|
T Consensus        27 ~~~~c~~c~~~f~~~e~~~~~~   48 (154)
T PRK00464         27 RRRECLACGKRFTTFERVELVP   48 (154)
T ss_pred             eeeeccccCCcceEeEeccCcc
Confidence            3499999999999877766655


No 88 
>KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion]
Probab=21.27  E-value=45  Score=28.85  Aligned_cols=14  Identities=21%  Similarity=0.577  Sum_probs=11.4

Q ss_pred             CcceeCCccccccC
Q 045333           68 PRSYTCTFCRREFR   81 (225)
Q Consensus        68 eKpy~C~~CgK~Fs   81 (225)
                      .+.++|..||.-|.
T Consensus       131 ge~~rc~eCG~~fk  144 (153)
T KOG3352|consen  131 GETQRCPECGHYFK  144 (153)
T ss_pred             CCcccCCcccceEE
Confidence            35788999998885


No 89 
>COG4640 Predicted membrane protein [Function unknown]
Probab=21.07  E-value=54  Score=32.62  Aligned_cols=23  Identities=26%  Similarity=0.504  Sum_probs=18.6

Q ss_pred             CCcceeCCccccccCCchhHHHH
Q 045333           67 PPRSYTCTFCRREFRSAQALGGH   89 (225)
Q Consensus        67 geKpy~C~~CgK~FsS~qALgGH   89 (225)
                      .|-.+.|+.||..|..++++..-
T Consensus        12 ~Ed~~qC~qCG~~~t~~~sqan~   34 (465)
T COG4640          12 AEDDVQCTQCGHKFTSRQSQANK   34 (465)
T ss_pred             ccccccccccCCcCCchhhhhhH
Confidence            34455699999999999998873


No 90 
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=20.76  E-value=46  Score=33.54  Aligned_cols=25  Identities=32%  Similarity=0.748  Sum_probs=21.6

Q ss_pred             eeCCccccccCCchhHHHHhh--hcCC
Q 045333           71 YTCTFCRREFRSAQALGGHMN--VHRR   95 (225)
Q Consensus        71 y~C~~CgK~FsS~qALgGHmr--~Htg   95 (225)
                      +-|-+|.|.|.+--+|..|.+  .|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEnSKKHke  319 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENSKKHKE  319 (508)
T ss_pred             eEEeeccccccchHHHHhhHHHHHHHH
Confidence            889999999999999999975  4543


No 91 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.64  E-value=39  Score=27.72  Aligned_cols=16  Identities=25%  Similarity=0.652  Sum_probs=13.3

Q ss_pred             CCcceeCCccccccCC
Q 045333           67 PPRSYTCTFCRREFRS   82 (225)
Q Consensus        67 geKpy~C~~CgK~FsS   82 (225)
                      +.--|+|+-|++.|.-
T Consensus        50 ~~qRyrC~~C~~tf~~   65 (129)
T COG3677          50 GHQRYKCKSCGSTFTV   65 (129)
T ss_pred             cccccccCCcCcceee
Confidence            3557999999999975


No 92 
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=20.27  E-value=68  Score=30.28  Aligned_cols=28  Identities=21%  Similarity=0.521  Sum_probs=24.7

Q ss_pred             CcceeCCccccccCCchhHHHHhhhcCC
Q 045333           68 PRSYTCTFCRREFRSAQALGGHMNVHRR   95 (225)
Q Consensus        68 eKpy~C~~CgK~FsS~qALgGHmr~Htg   95 (225)
                      ++-|-|.+|-|=|.+...|..|+...+-
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~C~~   73 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAKCDI   73 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHhCCC
Confidence            5789999999999999999999985543


No 93 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=20.23  E-value=45  Score=34.72  Aligned_cols=25  Identities=40%  Similarity=0.853  Sum_probs=18.8

Q ss_pred             eeCCccccccC---------------CchhHHHHh-hhcCC
Q 045333           71 YTCTFCRREFR---------------SAQALGGHM-NVHRR   95 (225)
Q Consensus        71 y~C~~CgK~Fs---------------S~qALgGHm-r~Htg   95 (225)
                      |.|.+|++.|.               +...|..|| ..|..
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~~  140 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHKL  140 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhhh
Confidence            67777777774               889999999 46654


No 94 
>COG1781 PyrI Aspartate carbamoyltransferase, regulatory subunit [Nucleotide transport and metabolism]
Probab=20.01  E-value=38  Score=29.26  Aligned_cols=16  Identities=19%  Similarity=0.845  Sum_probs=12.9

Q ss_pred             ceeCCccccccCCchh
Q 045333           70 SYTCTFCRREFRSAQA   85 (225)
Q Consensus        70 py~C~~CgK~FsS~qA   85 (225)
                      .|+|.||+|.|.....
T Consensus       135 ~lrC~YCe~~~~~~~v  150 (153)
T COG1781         135 ALRCKYCEKTFSEDEV  150 (153)
T ss_pred             EEEEEecCcEechhhh
Confidence            3999999999976543


Done!