Query         045334
Match_columns 80
No_of_seqs    102 out of 180
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 12:12:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045334.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045334hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3496 Cytochrome c oxidase a 100.0   1E-33 2.3E-38  183.4   6.2   72    1-80      1-72  (72)
  2 PF05051 COX17:  Cytochrome C o 100.0 2.8E-32   6E-37  166.0   1.2   48   33-80      2-49  (49)
  3 PF06747 CHCH:  CHCH domain;  I  90.2   0.076 1.7E-06   28.4  -0.2   30   45-74      3-34  (35)
  4 PLN03079 Uncharacterized prote  89.9    0.24 5.2E-06   33.6   1.9   33   43-75     18-60  (91)
  5 PF08583 Cmc1:  Cytochrome c ox  88.0    0.37   8E-06   28.7   1.7   20   60-79     11-30  (69)
  6 PF08991 DUF1903:  Domain of un  84.1    0.52 1.1E-05   29.9   1.0   26   51-76     12-39  (67)
  7 PF05254 UPF0203:  Uncharacteri  83.6    0.68 1.5E-05   29.4   1.4   34   42-75      8-51  (68)
  8 PF06747 CHCH:  CHCH domain;  I  83.1     1.1 2.3E-05   23.8   1.9   18   62-79      1-18  (35)
  9 KOG4114 Cytochrome c oxidase a  52.7      16 0.00035   24.1   2.5   29   48-76     27-59  (73)
 10 KOG3481 Uncharacterized conser  51.5      13 0.00029   25.2   2.0   34   42-75     12-55  (87)
 11 KOG4138 Unchracterized conserv  47.0      21 0.00045   24.6   2.5   33   43-75     43-76  (96)
 12 PF07956 DUF1690:  Protein of U  44.1      13 0.00029   26.2   1.3   24   51-74    117-142 (142)
 13 KOG3284 Vacuolar sorting prote  43.8      24 0.00052   27.3   2.6   17   60-76     56-72  (213)
 14 KOG0957 PHD finger protein [Ge  40.6      16 0.00035   32.2   1.4   20   30-49    111-131 (707)
 15 PF10249 NDUFB10:  NADH-ubiquin  39.5      23  0.0005   25.1   1.9   27   49-75     69-98  (128)
 16 KOG4624 Uncharacterized conser  37.1      34 0.00073   23.9   2.4   21   60-80     31-51  (104)
 17 KOG4618 Uncharacterized conser  34.8      41 0.00088   22.2   2.3   32   43-74     24-57  (74)
 18 PF00998 RdRP_3:  Viral RNA dep  33.5      25 0.00054   29.5   1.5   29   51-79    304-332 (486)
 19 KOG4009 NADH-ubiquinone oxidor  31.6      46 0.00099   24.7   2.4   26   51-76     87-115 (156)
 20 PF08036 Antimicrobial_6:  Diap  31.5      29 0.00063   20.5   1.1   17   42-58      9-25  (39)
 21 PF03997 VPS28:  VPS28 protein;  30.8      48   0.001   24.6   2.4   18   59-76     29-46  (188)
 22 PF03489 SapB_2:  Saposin-like   29.8      51  0.0011   17.2   1.8   11   60-70      2-12  (35)
 23 PF01841 Transglut_core:  Trans  29.2      27 0.00059   21.2   0.8   25   55-79     47-71  (113)
 24 smart00460 TGc Transglutaminas  29.0      44 0.00096   18.7   1.6   25   55-79      2-26  (68)
 25 cd03715 RT_ZFREV_like RT_ZFREV  24.6      80  0.0017   22.1   2.6   30   51-80    161-191 (210)
 26 PF08676 MutL_C:  MutL C termin  24.5      56  0.0012   21.4   1.7   18   63-80     65-82  (144)
 27 PF09034 TRADD_N:  TRADD, N-ter  24.1      64  0.0014   22.7   2.0   17   56-72     27-43  (111)
 28 PF10203 Pet191_N:  Cytochrome   23.5      79  0.0017   19.8   2.2   25   52-76     31-58  (68)
 29 PF11326 DUF3128:  Protein of u  22.3      60  0.0013   20.5   1.5   22   57-78     30-52  (84)
 30 PF03790 KNOX1:  KNOX1 domain ;  21.5      77  0.0017   18.9   1.7   13   62-74     13-25  (45)
 31 KOG4148 Uncharacterized conser  20.3      80  0.0017   22.1   1.8   18   59-76     10-27  (106)

No 1  
>KOG3496 consensus Cytochrome c oxidase assembly protein/Cu2+ chaperone COX17 [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=1e-33  Score=183.39  Aligned_cols=72  Identities=54%  Similarity=0.989  Sum_probs=59.2

Q ss_pred             CCCCCCCCCccccCCCCCCCCCCCccccCCCCCCCCCCccccCccchhhhhhhhhhccHHHHHHHHHHHHHHHHhcCCCC
Q 045334            1 MGGLPLQDASSTLALPGSQPNQGLEVTKSGTESKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV   80 (80)
Q Consensus         1 Mg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~KpCCaCpetK~~RDeCil~~ge~~C~~~Ieahk~Cmr~~GF~v   80 (80)
                      |.|++.+++.+..+-++        ..+..++.++|+|||||||+||++||.|||+||+++|.+|||+||.|||+|||+|
T Consensus         1 m~~l~~~s~at~~~~~~--------~~~~a~eek~K~KpCCaCpetK~~RDaCIle~gee~C~~lIEahk~CMr~~GF~v   72 (72)
T KOG3496|consen    1 MSGLTAQSSATESDKPA--------PQANAAEEKPKPKPCCACPETKKARDACILENGEEKCGKLIEAHKECMRAYGFEV   72 (72)
T ss_pred             CCcccccchhhccCCCc--------cccccccccCCCCccccCCchhhhhhhHhhhcCHHHHHHHHHHHHHHHHHcCCCC
Confidence            66766666555544441        2223456788999999999999999999999999999999999999999999997


No 2  
>PF05051 COX17:  Cytochrome C oxidase copper chaperone (COX17);  InterPro: IPR007745 Cox17p is essential for the assembly of functional cytochrome c oxidase (CCO) and for delivery of copper ions to the mitochondrion for insertion into the enzyme in Saccharomyces cerevisiae [].; GO: 0005507 copper ion binding, 0016531 copper chaperone activity, 0006825 copper ion transport, 0005758 mitochondrial intermembrane space; PDB: 1U97_A 1U96_A 1Z2G_A 2RNB_A 2RN9_A 2LGQ_A 2L0Y_B.
Probab=99.97  E-value=2.8e-32  Score=166.03  Aligned_cols=48  Identities=69%  Similarity=1.288  Sum_probs=41.6

Q ss_pred             CCCCCCccccCccchhhhhhhhhhccHHHHHHHHHHHHHHHHhcCCCC
Q 045334           33 SKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV   80 (80)
Q Consensus        33 ~~~k~KpCCaCpetK~~RDeCil~~ge~~C~~~Ieahk~Cmr~~GF~v   80 (80)
                      ++|++||||||||||++||+|||+||+++|++|||+||+|||+|||+|
T Consensus         2 ~kP~~KpCCaCpetK~aRDeC~l~~g~e~C~~~Ieahk~Cmr~~GF~v   49 (49)
T PF05051_consen    2 EKPKKKPCCACPETKKARDECILFNGEEDCKELIEAHKACMRGEGFKV   49 (49)
T ss_dssp             SS----TTTTSHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHTCCS
T ss_pred             CCCCCCcCccChhHHHHhHhhHHhcChHHHHHHHHHHHHHHHHcCCCC
Confidence            456689999999999999999999999999999999999999999997


No 3  
>PF06747 CHCH:  CHCH domain;  InterPro: IPR010625 A conserved motif was identified in the LOC118487 protein was called the CHCH motif. Alignment of this protein with related members showed the presence of three subgroups of proteins, which are called the S (Small), N (N-terminal extended) and C (C-terminal extended) subgroups. All three sub-groups of proteins have in common that they contain a predicted conserved [coiled coil 1]-[helix 1]-[coiled coil 2]-[helix 2] domain (CHCH domain). Within each helix of the CHCH domain, there are two cysteines present in a C-X9-C motif. The N-group contains an additional double helix domain, and each helix contains the C-X9-C motif. This family contains a number of characterised proteins: Cox19 protein - a nuclear gene of Saccharomyces cerevisiae, codes for an 11 kDa protein (Cox19p) required for expression of cytochrome oxidase. Because cox19 mutants are able to synthesise the mitochondrial and nuclear gene products of cytochrome oxidase, Cox19p probably functions post-translationally during assembly of the enzyme. Cox19p is present in the cytoplasm and mitochondria, where it exists as a soluble intermembrane protein. This dual location is similar to what was previously reported for Cox17p, a low molecular weight copper protein thought to be required for maturation of the CuA centre of subunit 2 of cytochrome oxidase. Cox19p have four conserved potential metal ligands, these are three cysteines and one histidine. Mrp10 - belongs to the class of yeast mitochondrial ribosomal proteins that are essential for translation []. Eukaryotic NADH-ubiquinone oxidoreductase 19 kDa (NDUFA8) subunit []. The CHCH domain was previously called DUF657 [].  ; PDB: 2ZXT_A 3A3C_A 2L0Y_A 2K3J_A.
Probab=90.16  E-value=0.076  Score=28.36  Aligned_cols=30  Identities=27%  Similarity=0.398  Sum_probs=20.7

Q ss_pred             cchhhhhhhhhhccH--HHHHHHHHHHHHHHH
Q 045334           45 ETKKLRDECIVEHGE--EACAKWIEAHRKCLR   74 (80)
Q Consensus        45 etK~~RDeCil~~ge--~~C~~~Ieahk~Cmr   74 (80)
                      ++.++==+|+-.|+.  ..|.+++++|++|+.
T Consensus         3 ~e~~~~~~Cl~~n~~~~~~C~~~~~~~~~C~~   34 (35)
T PF06747_consen    3 EEMKAYLACLKENNFDWSKCRKEFKAYKECRM   34 (35)
T ss_dssp             HHHHHHHHHHHCH-SSTCCCHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHCCCcHHhhHHHHHHHHHHhh
Confidence            333344467777654  489999999999975


No 4  
>PLN03079 Uncharacterized protein At4g33100; Provisional
Probab=89.86  E-value=0.24  Score=33.65  Aligned_cols=33  Identities=27%  Similarity=0.608  Sum_probs=28.2

Q ss_pred             Cccchhhhhhhhhh-------cc---HHHHHHHHHHHHHHHHh
Q 045334           43 CPETKKLRDECIVE-------HG---EEACAKWIEAHRKCLRA   75 (80)
Q Consensus        43 CpetK~~RDeCil~-------~g---e~~C~~~Ieahk~Cmr~   75 (80)
                      |.+.|..=|.|+..       .|   ++.|.++.+.|++|+..
T Consensus        18 CtelK~~YD~CFN~WYsEkFLKG~~~~~eC~~~w~~Yq~Cv~~   60 (91)
T PLN03079         18 CAELRTAYHNCFNRWYSEKFVKGQWDKEDCVAEWHKYRACLSE   60 (91)
T ss_pred             cHHHHHHHHHHHHHHHHHhhhcCCcccchHHHHHHHHHHHHHH
Confidence            99999999999982       23   46899999999999864


No 5  
>PF08583 Cmc1:  Cytochrome c oxidase biogenesis protein Cmc1 like;  InterPro: IPR013892 Cmc1 is a metallo-chaperone like protein which is known to localise to the inner mitochondrial membrane in Saccharomyces cerevisiae. It is essential for full expression of cytochrome c oxidase and respiration []. Cmc1 contains two Cx9C motifs and is able to bind copper(I). Cmc1 is thought to play a role in mitochondrial copper trafficking and transfer to cytochrome c oxidase.
Probab=87.99  E-value=0.37  Score=28.65  Aligned_cols=20  Identities=35%  Similarity=0.675  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHhcCCC
Q 045334           60 EACAKWIEAHRKCLRAEGFN   79 (80)
Q Consensus        60 ~~C~~~Ieahk~Cmr~~GF~   79 (80)
                      ..|.++|++|..|.++.+|.
T Consensus        11 ~~C~~~i~~~~~C~~~~~~~   30 (69)
T PF08583_consen   11 KKCADEIEAFAECHKDRTFK   30 (69)
T ss_pred             HHhHHHHHHHHHHHhcchHH
Confidence            68999999999999987664


No 6  
>PF08991 DUF1903:  Domain of unknown function (DUF1903);  InterPro: IPR009069 The mature-T-cell-proliferation (MTCP1) putative oncogene was identified for its involvement in t(X:14)(q28;q11)-associated T-cell leukaemia []. MTCP1 is alternatively spliced to produce two completely distinct proteins: the small mitochondrial protein, p8MTCP1, and the protein p13MTCP1, which shows strong homology to another oncogene product, p14TCL1. While p13MTCP1 expression appears to be restricted to mature T-cell proliferation with t(X,14) translocations, the mitochondrial p8MTCP1 is expressed at low levels in most human tissues, and is over-expressed in the proliferating T-cells. The biological function of p8MTCP1 is still unknown, but it appears to play a role in oncogenesis. The structure of p8MTCP1 reveals a disulphide-rich, irregular array of three helices [].; PDB: 2HP8_A 1EI0_A 1HP8_A.
Probab=84.06  E-value=0.52  Score=29.88  Aligned_cols=26  Identities=23%  Similarity=0.657  Sum_probs=21.1

Q ss_pred             hhhhhhcc--HHHHHHHHHHHHHHHHhc
Q 045334           51 DECIVEHG--EEACAKWIEAHRKCLRAE   76 (80)
Q Consensus        51 DeCil~~g--e~~C~~~Ieahk~Cmr~~   76 (80)
                      -.|+-.|+  ++.|.++|++|+.|-+.+
T Consensus        12 q~CL~~N~Yd~~kC~~~i~~l~~Cck~~   39 (67)
T PF08991_consen   12 QKCLQRNNYDESKCQDYIDALYECCKKF   39 (67)
T ss_dssp             HHHHHHTTT-CCCTHHHHHHHHHHHTTS
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHHHHHHH
Confidence            46777775  679999999999997765


No 7  
>PF05254 UPF0203:  Uncharacterised protein family (UPF0203);  InterPro: IPR007918 This is a family of small highly conserved proteins. In Saccharomyces cerevisiae (Baker's yeast) the gene YKL053C-A (MDM35) O60200 from SWISSPROT is one of the genes essential for maintenance of normal mitochondrial distribution and morphology (MDM) []; wherease in Homo sapiens (Human), p53CSV, O43715 from SWISSPROT is a direct transcriptional target for p53 and appears to be a cell-survival mediator in response to genotoxic stress including low-levels of DNA damage. It is suggested that p53CSV modulates the apoptotic pathway through interaction with HSP70 and Apaf-1 thereby inhibiting activation of procaspase-3 and procaspase-9 [].
Probab=83.63  E-value=0.68  Score=29.36  Aligned_cols=34  Identities=24%  Similarity=0.716  Sum_probs=28.1

Q ss_pred             cCccchhhhhhhhhh-------cc---HHHHHHHHHHHHHHHHh
Q 045334           42 ACPETKKLRDECIVE-------HG---EEACAKWIEAHRKCLRA   75 (80)
Q Consensus        42 aCpetK~~RDeCil~-------~g---e~~C~~~Ieahk~Cmr~   75 (80)
                      .|.+-|..=|.|+..       .|   ...|.++-+.|++|+..
T Consensus         8 eC~~lK~~YD~CFn~WfsekfLkG~~~~~~C~~~~~~Y~~Cv~~   51 (68)
T PF05254_consen    8 ECTELKEKYDQCFNKWFSEKFLKGDSSDNECGELFKEYQQCVQK   51 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhcCCCCCCcHHHHHHHHHHHHHH
Confidence            488999999999982       24   35899999999999864


No 8  
>PF06747 CHCH:  CHCH domain;  InterPro: IPR010625 A conserved motif was identified in the LOC118487 protein was called the CHCH motif. Alignment of this protein with related members showed the presence of three subgroups of proteins, which are called the S (Small), N (N-terminal extended) and C (C-terminal extended) subgroups. All three sub-groups of proteins have in common that they contain a predicted conserved [coiled coil 1]-[helix 1]-[coiled coil 2]-[helix 2] domain (CHCH domain). Within each helix of the CHCH domain, there are two cysteines present in a C-X9-C motif. The N-group contains an additional double helix domain, and each helix contains the C-X9-C motif. This family contains a number of characterised proteins: Cox19 protein - a nuclear gene of Saccharomyces cerevisiae, codes for an 11 kDa protein (Cox19p) required for expression of cytochrome oxidase. Because cox19 mutants are able to synthesise the mitochondrial and nuclear gene products of cytochrome oxidase, Cox19p probably functions post-translationally during assembly of the enzyme. Cox19p is present in the cytoplasm and mitochondria, where it exists as a soluble intermembrane protein. This dual location is similar to what was previously reported for Cox17p, a low molecular weight copper protein thought to be required for maturation of the CuA centre of subunit 2 of cytochrome oxidase. Cox19p have four conserved potential metal ligands, these are three cysteines and one histidine. Mrp10 - belongs to the class of yeast mitochondrial ribosomal proteins that are essential for translation []. Eukaryotic NADH-ubiquinone oxidoreductase 19 kDa (NDUFA8) subunit []. The CHCH domain was previously called DUF657 [].  ; PDB: 2ZXT_A 3A3C_A 2L0Y_A 2K3J_A.
Probab=83.12  E-value=1.1  Score=23.77  Aligned_cols=18  Identities=33%  Similarity=0.756  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHhcCCC
Q 045334           62 CAKWIEAHRKCLRAEGFN   79 (80)
Q Consensus        62 C~~~Ieahk~Cmr~~GF~   79 (80)
                      |...+.+|-.||+..+|+
T Consensus         1 C~~e~~~~~~Cl~~n~~~   18 (35)
T PF06747_consen    1 CAEEMKAYLACLKENNFD   18 (35)
T ss_dssp             THHHHHHHHHHHHCH-SS
T ss_pred             CHHHHHHHHHHHHHCCCc
Confidence            788999999999999985


No 9  
>KOG4114 consensus Cytochrome c oxidase assembly protein PET191 [Posttranslational modification, protein turnover, chaperones]
Probab=52.75  E-value=16  Score=24.09  Aligned_cols=29  Identities=28%  Similarity=0.499  Sum_probs=22.1

Q ss_pred             hhhhhhhhhcc----HHHHHHHHHHHHHHHHhc
Q 045334           48 KLRDECIVEHG----EEACAKWIEAHRKCLRAE   76 (80)
Q Consensus        48 ~~RDeCil~~g----e~~C~~~Ieahk~Cmr~~   76 (80)
                      +.=.||+-.++    .++|..+|++|..|=|+.
T Consensus        27 ks~reCldn~~~~~vPeeC~al~~af~dCKRsl   59 (73)
T KOG4114|consen   27 KSPRECLDNPELKDVPEECIALMKAFLDCKRSL   59 (73)
T ss_pred             CCHHHHhcCCccccCcHHHHHHHHHHHHHHHHH
Confidence            33347777666    479999999999998863


No 10 
>KOG3481 consensus Uncharacterized conserved protein [Function unknown]
Probab=51.47  E-value=13  Score=25.18  Aligned_cols=34  Identities=26%  Similarity=0.762  Sum_probs=27.7

Q ss_pred             cCccchhhhhhhhhh-------cc---HHHHHHHHHHHHHHHHh
Q 045334           42 ACPETKKLRDECIVE-------HG---EEACAKWIEAHRKCLRA   75 (80)
Q Consensus        42 aCpetK~~RDeCil~-------~g---e~~C~~~Ieahk~Cmr~   75 (80)
                      .|-+-|..=|.|+-.       .|   .+.|..|-..|++|+..
T Consensus        12 eCt~lk~~YD~CFn~Wf~eKflKG~~~~~pC~~l~k~Y~~Cv~k   55 (87)
T KOG3481|consen   12 ECTDLKQKYDQCFNEWFSEKFLKGDSSGEPCSRLFKVYKQCVQK   55 (87)
T ss_pred             cchHHHHHHHHHHHHHHHHHhcCCccccCcHHHHHHHHHHHHHH
Confidence            378899999999863       23   46899999999999853


No 11 
>KOG4138 consensus Unchracterized conserved protein (estrogen up-regulated protein E2IG2 in human) [General function prediction only]
Probab=47.04  E-value=21  Score=24.59  Aligned_cols=33  Identities=24%  Similarity=0.626  Sum_probs=24.6

Q ss_pred             CccchhhhhhhhhhccH-HHHHHHHHHHHHHHHh
Q 045334           43 CPETKKLRDECIVEHGE-EACAKWIEAHRKCLRA   75 (80)
Q Consensus        43 CpetK~~RDeCil~~ge-~~C~~~Ieahk~Cmr~   75 (80)
                      |-++--+=.+|+..++. -.|...+++||.||..
T Consensus        43 C~~ehlalq~C~a~t~DWRqC~~qm~~FrkCwek   76 (96)
T KOG4138|consen   43 CAAEHLALQECMAQTQDWRQCQPQMQAFRKCWEK   76 (96)
T ss_pred             hHHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHH
Confidence            44455555667666654 5899999999999976


No 12 
>PF07956 DUF1690:  Protein of Unknown function (DUF1690) ;  InterPro: IPR012471 Family of uncharacterised fungal proteins. 
Probab=44.05  E-value=13  Score=26.18  Aligned_cols=24  Identities=25%  Similarity=0.446  Sum_probs=19.7

Q ss_pred             hhhhhhccH--HHHHHHHHHHHHHHH
Q 045334           51 DECIVEHGE--EACAKWIEAHRKCLR   74 (80)
Q Consensus        51 DeCil~~ge--~~C~~~Ieahk~Cmr   74 (80)
                      =.|+..|.-  =+|-+.||+||.|.+
T Consensus       117 v~CL~~N~~rPLnCw~EVe~FKk~V~  142 (142)
T PF07956_consen  117 VRCLRENDGRPLNCWEEVEAFKKEVK  142 (142)
T ss_pred             HHHHHHCCCCCCchHHHHHHHHHHhC
Confidence            369998853  499999999999864


No 13 
>KOG3284 consensus Vacuolar sorting protein VPS28 [Intracellular trafficking, secretion, and vesicular transport]
Probab=43.75  E-value=24  Score=27.28  Aligned_cols=17  Identities=24%  Similarity=0.440  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHhc
Q 045334           60 EACAKWIEAHRKCLRAE   76 (80)
Q Consensus        60 ~~C~~~Ieahk~Cmr~~   76 (80)
                      ..|..||.+||.||++.
T Consensus        56 s~c~kLi~Q~k~~~~~~   72 (213)
T KOG3284|consen   56 SECSKLIVQYKVAFRSV   72 (213)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            47999999999999974


No 14 
>KOG0957 consensus PHD finger protein [General function prediction only]
Probab=40.61  E-value=16  Score=32.16  Aligned_cols=20  Identities=45%  Similarity=0.941  Sum_probs=13.8

Q ss_pred             CCCCCCCCC-ccccCccchhh
Q 045334           30 GTESKPKKK-ICCACPETKKL   49 (80)
Q Consensus        30 ~~~~~~k~K-pCCaCpetK~~   49 (80)
                      ...+.|++. +||||.-.+..
T Consensus       111 ~~~Sapkk~~iCcVClg~rs~  131 (707)
T KOG0957|consen  111 RTPSAPKKAVICCVCLGQRSV  131 (707)
T ss_pred             cccCccccceEEEEeecCccc
Confidence            334556655 99999988743


No 15 
>PF10249 NDUFB10:  NADH-ubiquinone oxidoreductase subunit 10;  InterPro: IPR019377 NADH-ubiquinone oxidoreductase subunit 10 of (NDUFB10) is a member of a family of conserved proteins of up to 180 residues. It is one of the 41 protein subunits within the hydrophobic fraction of the NADH:ubiquinone oxidoreductase (complex I), a multiprotein complex located in the inner mitochondrial membrane whose main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. NDUFB10 is encoded in the nucleus. 
Probab=39.48  E-value=23  Score=25.13  Aligned_cols=27  Identities=19%  Similarity=0.433  Sum_probs=20.8

Q ss_pred             hhhhhhhhccH---HHHHHHHHHHHHHHHh
Q 045334           49 LRDECIVEHGE---EACAKWIEAHRKCLRA   75 (80)
Q Consensus        49 ~RDeCil~~ge---~~C~~~Ieahk~Cmr~   75 (80)
                      ..++|...+|.   .+|+++|++|..=.+.
T Consensus        69 Rl~~C~~~EG~nh~qnC~~l~~qy~ea~~~   98 (128)
T PF10249_consen   69 RLEACYRREGVNHYQNCRKLVEQYEEAAKN   98 (128)
T ss_pred             HHHHHHHHHCcCHhhhhHHHHHHHHHHHHH
Confidence            34689998886   5799999999865443


No 16 
>KOG4624 consensus Uncharacterized conserved protein [Function unknown]
Probab=37.13  E-value=34  Score=23.86  Aligned_cols=21  Identities=29%  Similarity=0.817  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHhcCCCC
Q 045334           60 EACAKWIEAHRKCLRAEGFNV   80 (80)
Q Consensus        60 ~~C~~~Ieahk~Cmr~~GF~v   80 (80)
                      ++|.+++.+|-.|-++-||.|
T Consensus        31 ~~C~~~v~~~a~C~k~~~v~v   51 (104)
T KOG4624|consen   31 EKCSEFVQDFADCAKASGVSV   51 (104)
T ss_pred             HHHHHHHHHHHHHHhcCCeee
Confidence            689999999999999999864


No 17 
>KOG4618 consensus Uncharacterized conserved protein [Function unknown]
Probab=34.84  E-value=41  Score=22.23  Aligned_cols=32  Identities=16%  Similarity=0.554  Sum_probs=25.2

Q ss_pred             Cccchhhhhhhhhhcc--HHHHHHHHHHHHHHHH
Q 045334           43 CPETKKLRDECIVEHG--EEACAKWIEAHRKCLR   74 (80)
Q Consensus        43 CpetK~~RDeCil~~g--e~~C~~~Ieahk~Cmr   74 (80)
                      |..+-.+-=.|+=+|+  -++|.+..+.||.|=+
T Consensus        24 Cl~es~aSfkCLeennyDRsKCq~yFd~YkeCKk   57 (74)
T KOG4618|consen   24 CLLESSASFKCLEENNYDRSKCQDYFDVYKECKK   57 (74)
T ss_pred             HHHHHHHHHHHHHhcCccHHHHHHHHHHHHHHHH
Confidence            4566666667887776  4699999999999965


No 18 
>PF00998 RdRP_3:  Viral RNA dependent RNA polymerase;  InterPro: IPR002166 The RNA dependent RNA polymerase is also known as non-structural protein NS5B. NS5B is a 65 kDa protein that resembles other viral RNA polymerases. Hepatitis C virus (HCV) replication is thought to occur in membrane bound replication complexes. These complexes transcribe the positive strand and the resulting minus strand is used as a template for the synthesis of genomic RNA. There are two viral proteins involved in the reaction, NS3 and NS5B [, , ].; GO: 0003723 RNA binding, 0003968 RNA-directed RNA polymerase activity, 0005524 ATP binding, 0006351 transcription, DNA-dependent, 0019079 viral genome replication; PDB: 2XYM_A 3I5K_D 4AEX_A 4E7A_A 2XXD_A 4E78_A 4AEP_A 4E76_A 1S4F_D 1S48_A ....
Probab=33.55  E-value=25  Score=29.45  Aligned_cols=29  Identities=21%  Similarity=0.318  Sum_probs=22.6

Q ss_pred             hhhhhhccHHHHHHHHHHHHHHHHhcCCC
Q 045334           51 DECIVEHGEEACAKWIEAHRKCLRAEGFN   79 (80)
Q Consensus        51 DeCil~~ge~~C~~~Ieahk~Cmr~~GF~   79 (80)
                      |+|+|.--...+.++.++...-|..|||.
T Consensus       304 DD~vvi~E~~~~~~~~~~l~~~~~~~Gf~  332 (486)
T PF00998_consen  304 DDCVVICESAGVDEDEAALTEAFTRYGFP  332 (486)
T ss_dssp             TEEEEEEEHCHHHHHHHHHHHHHHHTT-B
T ss_pred             CceEEEecccchHHHHHHHHHHHHhcCCC
Confidence            67777665667777778999999999996


No 19 
>KOG4009 consensus NADH-ubiquinone oxidoreductase, subunit NDUFB10/PDSW [Energy production and conversion]
Probab=31.58  E-value=46  Score=24.65  Aligned_cols=26  Identities=23%  Similarity=0.419  Sum_probs=20.7

Q ss_pred             hhhhhhccHH---HHHHHHHHHHHHHHhc
Q 045334           51 DECIVEHGEE---ACAKWIEAHRKCLRAE   76 (80)
Q Consensus        51 DeCil~~ge~---~C~~~Ieahk~Cmr~~   76 (80)
                      +.|++.+|..   +|.++||+|.+=-+.|
T Consensus        87 k~C~lye~pnh~q~C~k~veq~e~~~~n~  115 (156)
T KOG4009|consen   87 KWCYLYEGPNHYQKCRKLVEQYEDATRNY  115 (156)
T ss_pred             HHHHHHhCcchHhHHHHHHHHHHHHHHHH
Confidence            5799988864   7999999998765543


No 20 
>PF08036 Antimicrobial_6:  Diapausin family of antimicrobial peptide;  InterPro: IPR012525 This family consists of diapausin-related antimicrobial peptides. Diapause during periods of environmental adversity is an essential part of the life cycle of many organisms with the molecular basis being different among animals. Diapause-specific peptides provide anti-fungal activity and act as N-type voltage-gated calcium channel blocker [].; GO: 0050832 defense response to fungus, 0005576 extracellular region; PDB: 2E2F_A.
Probab=31.46  E-value=29  Score=20.46  Aligned_cols=17  Identities=41%  Similarity=0.798  Sum_probs=14.0

Q ss_pred             cCccchhhhhhhhhhcc
Q 045334           42 ACPETKKLRDECIVEHG   58 (80)
Q Consensus        42 aCpetK~~RDeCil~~g   58 (80)
                      ||+-+-..||||---||
T Consensus         9 vC~R~~~Er~eCCrAhG   25 (39)
T PF08036_consen    9 VCSRIVPERDECCRAHG   25 (39)
T ss_dssp             STTS-STTTHHHHHHTT
T ss_pred             cccCcchhHHHHHHHcC
Confidence            79999999999987776


No 21 
>PF03997 VPS28:  VPS28 protein;  InterPro: IPR007143 The Endosomal Sorting Complex Required for Transport (ESCRT) complexes form the machinery driving protein sorting from endosomes to lysosomes. ESCRT complexes are central to receptor down-regulation, lysosome biogenesis, and budding of HIV. Yeast ESCRT-I consists of three protein subunits, VPS23, VPS28, and VPS37. In humans, ESCRT-I comprises TSG101, VPS28, and one of four potential human VPS37 homologues. The main role of ESCRT-I is to recognise ubiquitinated cargo via the UEV domain of the VPS23/TSG101 subunit. The assembly of the ESCRT-I complex is directed by the C-terminal steadiness box (SB) of VPS23, the N-terminal half of VPS28, and the C-terminal half of VPS37. The structure is primarily composed of three long, parallel helical hairpins, each corresponding to a different subunit. The additional domains and motifs extending beyond the core serve as gripping tools for ESCRT-I critical functions [, ].; PDB: 2J9W_B 2J9U_C 2G3K_A 2F66_E 2F6M_D 2J9V_A 2CAZ_E 2P22_B.
Probab=30.83  E-value=48  Score=24.60  Aligned_cols=18  Identities=22%  Similarity=0.420  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHhc
Q 045334           59 EEACAKWIEAHRKCLRAE   76 (80)
Q Consensus        59 e~~C~~~Ieahk~Cmr~~   76 (80)
                      ...|..||.+||..++..
T Consensus        29 t~~c~kLl~Qyk~~~~~~   46 (188)
T PF03997_consen   29 TTACNKLLNQYKTILKQL   46 (188)
T ss_dssp             HHHHHHHHHHHHHHHTST
T ss_pred             HHHHHHHHHHHHHHHHHc
Confidence            458999999999999865


No 22 
>PF03489 SapB_2:  Saposin-like type B, region 2;  InterPro: IPR008138 Saposins are small lysosomal proteins that serve as activators of various lysosomal lipid-degrading enzymes []. They probably act by isolating the lipid substrate from the membrane surroundings, thus making it more accessible to the soluble degradative enzymes. All mammalian saposins are synthesized as a single precursor molecule (prosaposin) which contains four Saposin-B domains, yielding the active saposins after proteolytic cleavage, and two Saposin-A domains that are removed in the activation reaction. The Saposin-B domains also occur in other proteins, many of them active in the lysis of membranes [, ].; PDB: 3BQQ_A 2RB3_B 2R0R_A 3BQP_A 2R1Q_A 1NKL_A 1L9L_A 1QDM_C 3RFI_A 4DDJ_A ....
Probab=29.77  E-value=51  Score=17.17  Aligned_cols=11  Identities=9%  Similarity=0.625  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHH
Q 045334           60 EACAKWIEAHR   70 (80)
Q Consensus        60 ~~C~~~Ieahk   70 (80)
                      +.|+.+|+.|-
T Consensus         2 ~~C~~~V~~y~   12 (35)
T PF03489_consen    2 DECKNFVDQYG   12 (35)
T ss_dssp             HHHHHHHHHHH
T ss_pred             cHHHHHHHHHH
Confidence            57999999984


No 23 
>PF01841 Transglut_core:  Transglutaminase-like superfamily;  InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i.e. which cross-link proteins through an acyl-transfer reaction between the gamma-carboxamide group of peptide-bound glutamine and the epsilon-amino group of peptide-bound lysine, resulting in a epsilon-(gamma-glutamyl)lysine isopeptide bond. Tranglutaminases have been found in a diverse range of species, from bacteria through to mammals. The enzymes require calcium binding and their activity leads to post-translational modification of proteins through acyl-transfer reactions, involving peptidyl glutamine residues as acyl donors and a variety of primary amines as acyl acceptors, with the generation of proteinase resistant isopeptide bonds [].  Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterised transglutaminase, the human blood clotting factor XIIIa' []. On the basis of the experimentally demonstrated activity of the Methanobacterium phage psiM2 pseudomurein endoisopeptidase [], it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease [].  A subunit of plasma Factor XIII revealed that each Factor XIIIA subunit is composed of four domains (termed N-terminal beta-sandwich, core domain (containing the catalytic and the regulatory sites), and C-terminal beta-barrels 1 and 2) and that two monomers assemble into the native dimer through the surfaces in domains 1 and 2, in opposite orientation. This organisation in four domains is highly conserved during evolution among transglutaminase isoforms [].; PDB: 2F4M_A 2F4O_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B ....
Probab=29.24  E-value=27  Score=21.24  Aligned_cols=25  Identities=24%  Similarity=0.444  Sum_probs=19.7

Q ss_pred             hhccHHHHHHHHHHHHHHHHhcCCC
Q 045334           55 VEHGEEACAKWIEAHRKCLRAEGFN   79 (80)
Q Consensus        55 l~~ge~~C~~~Ieahk~Cmr~~GF~   79 (80)
                      |+.+...|.++=..+...||..|+.
T Consensus        47 l~~~~G~C~~~a~l~~allr~~Gip   71 (113)
T PF01841_consen   47 LRSGRGDCEDYASLFVALLRALGIP   71 (113)
T ss_dssp             HHCEEESHHHHHHHHHHHHHHHT--
T ss_pred             HHcCCCccHHHHHHHHHHHhhCCCc
Confidence            3455568999999999999999985


No 24 
>smart00460 TGc Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
Probab=29.05  E-value=44  Score=18.71  Aligned_cols=25  Identities=16%  Similarity=0.311  Sum_probs=21.3

Q ss_pred             hhccHHHHHHHHHHHHHHHHhcCCC
Q 045334           55 VEHGEEACAKWIEAHRKCLRAEGFN   79 (80)
Q Consensus        55 l~~ge~~C~~~Ieahk~Cmr~~GF~   79 (80)
                      |.++...|.++...+..=||..|+.
T Consensus         2 ~~~~~G~C~~~a~l~~~llr~~GIp   26 (68)
T smart00460        2 LKTKYGTCGEFAALFVALLRSLGIP   26 (68)
T ss_pred             CcccceeeHHHHHHHHHHHHHCCCC
Confidence            4566778999999999999999975


No 25 
>cd03715 RT_ZFREV_like RT_ZFREV_like: A subfamily of reverse transcriptases (RTs) found in sequences similar to the intact endogenous retrovirus ZFERV from zebrafish and to Moloney murine leukemia virus RT.  An RT gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. RTs occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. These elements can be divided into two major groups. One group contains retroviruses and DNA viruses whose propagation involves an RNA intermediate. They are grouped together with transposable elements containing long terminal repeats (LTRs). The other group, also called poly(A)-type retrotransposons, contain fungal mitochondrial introns and transposable elements that lack LTRs. Phylogenetic analysis suggests that  ZFERV belongs to a distinct group of retroviruses.
Probab=24.59  E-value=80  Score=22.07  Aligned_cols=30  Identities=30%  Similarity=0.465  Sum_probs=23.2

Q ss_pred             hhhhhhc-cHHHHHHHHHHHHHHHHhcCCCC
Q 045334           51 DECIVEH-GEEACAKWIEAHRKCLRAEGFNV   80 (80)
Q Consensus        51 DeCil~~-ge~~C~~~Ieahk~Cmr~~GF~v   80 (80)
                      |+.++.. ..++|.+.++.-...|+.+||.+
T Consensus       161 DDili~s~~~~e~~~~l~~v~~~l~~~gl~l  191 (210)
T cd03715         161 DDLLLAADSEEDCLKGTDALLTHLGELGYKV  191 (210)
T ss_pred             CcEEEecCCHHHHHHHHHHHHHHHHHCCCCc
Confidence            4444433 46789999999999999999975


No 26 
>PF08676 MutL_C:  MutL C terminal dimerisation domain;  InterPro: IPR014790 MutL and MutS are key components of the DNA repair machinery that corrects replication errors []. MutS recognises mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signalling complex for repair. The N-terminal region of MutL contains the ATPase domain and the C-terminal is involved in dimerisation []. ; GO: 0005524 ATP binding, 0006298 mismatch repair; PDB: 3NCV_B 1X9Z_B 3GAB_C 3KDK_A 3KDG_A.
Probab=24.50  E-value=56  Score=21.40  Aligned_cols=18  Identities=28%  Similarity=0.560  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHhcCCCC
Q 045334           63 AKWIEAHRKCLRAEGFNV   80 (80)
Q Consensus        63 ~~~Ieahk~Cmr~~GF~v   80 (80)
                      .++++.|+.=|+..||++
T Consensus        65 ~~~l~~~~~~L~~~Gf~~   82 (144)
T PF08676_consen   65 AELLEENKEELEKLGFEI   82 (144)
T ss_dssp             HHHHHHHHHHHHHTT-EE
T ss_pred             HHHHHHHHHHHHhCCeEE
Confidence            478999999999999974


No 27 
>PF09034 TRADD_N:  TRADD, N-terminal domain;  InterPro: IPR009095 TRADD is a signalling adaptor protein involved in tumour necrosis factor-receptor I (TNFR1)-associated apoptosis and cell survival. The decision between apoptosis and cell survival involves the interplay between two sequential signalling complexes. The plasma membrane-bound complex I is comprised of TNFR1, TRADD, the kinase RIP1, and TRAF2, which together mediate the activation of NF-kappaB. Subsequently, complex II is formed in the cytoplasm, where TRADD and RIP1 associate with FADD and caspase-8. If NF-kappaB is activated by complex I, then complex II will associate with the caspase-8 inhibitor FLIP(L) and the cell survives, while the failure to activate NF-kappaB leads to apoptosis []. The TRADD C-terminal death domain is responsible for its association with TNFR1, and with the death-domain proteins FADD and RIP1, which promote apoptosis. The TRADD N-terminal domain binds TRAF2 and promotes TRAF2 recruitment to TNFR1, thereby mediating the activation of NK-kappaB and JNK/AP1, which promote cell survival []. The N-terminal TRADD domain is composed of an alpha-beta sandwich, where the beta strands form an antiparallel beta-sheet.; GO: 0004871 signal transducer activity, 0006917 induction of apoptosis, 0043123 positive regulation of I-kappaB kinase/NF-kappaB cascade, 0005737 cytoplasm; PDB: 1F3V_A 1F2H_A.
Probab=24.13  E-value=64  Score=22.74  Aligned_cols=17  Identities=24%  Similarity=0.567  Sum_probs=15.2

Q ss_pred             hccHHHHHHHHHHHHHH
Q 045334           56 EHGEEACAKWIEAHRKC   72 (80)
Q Consensus        56 ~~ge~~C~~~Ieahk~C   72 (80)
                      |.|.+.|..|+++|+.+
T Consensus        27 F~~~~~C~rFL~sYreG   43 (111)
T PF09034_consen   27 FCGREPCRRFLRSYREG   43 (111)
T ss_dssp             EESHHHHHHHHHHHHCC
T ss_pred             EcCchhHHHHHHHHhcc
Confidence            77999999999999864


No 28 
>PF10203 Pet191_N:  Cytochrome c oxidase assembly protein PET191;  InterPro: IPR018793 This entry represents a family of conserved proteins found from nematodes to humans. Cytochrome c oxidase assembly protein Pet191 carries six highly conserved cysteine residues. Pet191 is required for the assembly of active cytochrome c oxidase but does not form part of the final assembled complex []. 
Probab=23.51  E-value=79  Score=19.85  Aligned_cols=25  Identities=24%  Similarity=0.590  Sum_probs=18.7

Q ss_pred             hhhhhcc---HHHHHHHHHHHHHHHHhc
Q 045334           52 ECIVEHG---EEACAKWIEAHRKCLRAE   76 (80)
Q Consensus        52 eCil~~g---e~~C~~~Ieahk~Cmr~~   76 (80)
                      +|+-.+.   .++|..|..+|-+|=|+.
T Consensus        31 ~Cl~~~~~~~p~eC~~lr~~f~eCKrg~   58 (68)
T PF10203_consen   31 DCLKDPSDELPEECQQLRKAFFECKRGM   58 (68)
T ss_pred             HHHcCCCCcCCHHHHHHHHHHHHHhccc
Confidence            4555442   468999999999998763


No 29 
>PF11326 DUF3128:  Protein of unknown function (DUF3128);  InterPro: IPR021475  This eukaryotic family of proteins has no known function. 
Probab=22.33  E-value=60  Score=20.50  Aligned_cols=22  Identities=36%  Similarity=0.824  Sum_probs=18.2

Q ss_pred             ccH-HHHHHHHHHHHHHHHhcCC
Q 045334           57 HGE-EACAKWIEAHRKCLRAEGF   78 (80)
Q Consensus        57 ~ge-~~C~~~Ieahk~Cmr~~GF   78 (80)
                      +|+ ..|....+.|+.||+-..+
T Consensus        30 yG~~~~C~~~~~df~~C~~~k~~   52 (84)
T PF11326_consen   30 YGEFDDCSQWWEDFKFCLRWKSK   52 (84)
T ss_pred             cCCCccHHHHHHHHHHHHHhccC
Confidence            466 5899999999999986654


No 30 
>PF03790 KNOX1:  KNOX1 domain ;  InterPro: IPR005540 The MEINOX region is comprised of two domains, KNOX1 and KNOX2. KNOX1 plays a role in suppressing target gene expression. KNOX2, essential for function, is thought to be necessary for homo-dimerization [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=21.48  E-value=77  Score=18.93  Aligned_cols=13  Identities=15%  Similarity=0.399  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHH
Q 045334           62 CAKWIEAHRKCLR   74 (80)
Q Consensus        62 C~~~Ieahk~Cmr   74 (80)
                      .-.|++||-.|+|
T Consensus        13 Y~~Ll~Ayi~C~K   25 (45)
T PF03790_consen   13 YPRLLAAYIDCQK   25 (45)
T ss_pred             cHHHHHHHHHHHh
Confidence            4579999999987


No 31 
>KOG4148 consensus Uncharacterized conserved protein [Function unknown]
Probab=20.32  E-value=80  Score=22.07  Aligned_cols=18  Identities=28%  Similarity=0.680  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHhc
Q 045334           59 EEACAKWIEAHRKCLRAE   76 (80)
Q Consensus        59 e~~C~~~Ieahk~Cmr~~   76 (80)
                      .+.|.+||.|-+.|-+..
T Consensus        10 ~~~C~dlInaL~eCH~~~   27 (106)
T KOG4148|consen   10 HEECNDLINALKECHKNH   27 (106)
T ss_pred             HHHHHHHHHHHHHHHhhh
Confidence            468999999999997544


Done!