Citrus Sinensis ID: 045334

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MGGLPLQDASSTLALPGSQPNQGLEVTKSGTESKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV
ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccc
**************************************ICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGLPLQDASSTLALPGSQPNQGLEVTKSGTESKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase copper chaperone Copper chaperone for cytochrome c oxidase (COX). Binds two copper ions and deliver them to the Cu(A) site of COX.probableQ54ID0
Cytochrome c oxidase copper chaperone Copper chaperone for cytochrome c oxidase (COX). Binds two copper ions and deliver them to the Cu(A) site of COX.probableQ14061
Cytochrome c oxidase copper chaperone Copper chaperone for cytochrome c oxidase (COX). Binds two copper ions and deliver them to the Cu(A) site of COX.probableP81045

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0Y, chain B
Confidence level:very confident
Coverage over the Query: 60-80
View the alignment between query and template
View the model in PyMOL