BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 045342
(243 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3VSK|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
From Methicilin-Resistant Staphylococcus Aureus In The
Apo Form.
pdb|3VSK|B Chain B, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
From Methicilin-Resistant Staphylococcus Aureus In The
Apo Form.
pdb|3VSL|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
From Methicilin-Resistant Staphylococcus Aureus In The
Cefotaxime Bound Form.
pdb|3VSL|B Chain B, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
From Methicilin-Resistant Staphylococcus Aureus In The
Cefotaxime Bound Form
Length = 646
Score = 30.4 bits (67), Expect = 0.85, Method: Compositional matrix adjust.
Identities = 14/50 (28%), Positives = 27/50 (54%)
Query: 49 EKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTA 98
++L H+L K + + + + Q++D L +K MKYT++ VT+
Sbjct: 209 KELTEHYLSKGYSRNDRVGKSYLEYQYEDVLRGKKKEMKYTTDKSGKVTS 258
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.138 0.401
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,442,758
Number of Sequences: 62578
Number of extensions: 225847
Number of successful extensions: 844
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 842
Number of HSP's gapped (non-prelim): 5
length of query: 243
length of database: 14,973,337
effective HSP length: 96
effective length of query: 147
effective length of database: 8,965,849
effective search space: 1317979803
effective search space used: 1317979803
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)