BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045342
         (243 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3VSK|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
           From Methicilin-Resistant Staphylococcus Aureus In The
           Apo Form.
 pdb|3VSK|B Chain B, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
           From Methicilin-Resistant Staphylococcus Aureus In The
           Apo Form.
 pdb|3VSL|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
           From Methicilin-Resistant Staphylococcus Aureus In The
           Cefotaxime Bound Form.
 pdb|3VSL|B Chain B, Crystal Structure Of Penicillin-Binding Protein 3 (Pbp3)
           From Methicilin-Resistant Staphylococcus Aureus In The
           Cefotaxime Bound Form
          Length = 646

 Score = 30.4 bits (67), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%)

Query: 49  EKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTA 98
           ++L  H+L K  + + +  +     Q++D L   +K MKYT++    VT+
Sbjct: 209 KELTEHYLSKGYSRNDRVGKSYLEYQYEDVLRGKKKEMKYTTDKSGKVTS 258


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.138    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,442,758
Number of Sequences: 62578
Number of extensions: 225847
Number of successful extensions: 844
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 842
Number of HSP's gapped (non-prelim): 5
length of query: 243
length of database: 14,973,337
effective HSP length: 96
effective length of query: 147
effective length of database: 8,965,849
effective search space: 1317979803
effective search space used: 1317979803
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)