Query         045369
Match_columns 117
No_of_seqs    170 out of 637
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 12:35:09 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045369.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045369hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1110 Putative steroid membr  99.8 4.1E-19 8.9E-24  137.2   7.9   90   15-117     1-91  (183)
  2 KOG1108 Predicted heme/steroid  99.2 6.7E-12 1.5E-16  101.4   3.8   82   22-116    13-94  (281)
  3 COG4892 Predicted heme/steroid  99.2 2.2E-11 4.8E-16   82.9   3.8   33   81-115     1-33  (81)
  4 PF00173 Cyt-b5:  Cytochrome b5  98.2 6.9E-07 1.5E-11   57.6   2.2   29   84-115     2-30  (76)
  5 KOG0536 Flavohemoprotein b5+b5  97.9 1.2E-05 2.5E-10   60.6   3.5   29   83-114    69-97  (145)
  6 COG5274 CYB5 Cytochrome b invo  96.9 0.00095 2.1E-08   51.4   3.4   31   82-115    50-80  (164)
  7 PLN03198 delta6-acyl-lipid des  96.4  0.0031 6.7E-08   55.5   3.4   32   80-114   102-133 (526)
  8 PLN03199 delta6-acyl-lipid des  96.4  0.0036 7.7E-08   54.3   3.7   30   82-114    24-53  (485)
  9 PLN02252 nitrate reductase [NA  95.7   0.012 2.5E-07   54.9   4.1   32   80-114   516-547 (888)
 10 KOG4576 Sulfite oxidase, heme-  90.0    0.24 5.3E-06   37.9   2.3   30   83-114    81-110 (167)
 11 KOG4232 Delta 6-fatty acid des  74.5     1.4 3.1E-05   38.6   1.0   29   82-114     8-36  (430)
 12 PF14901 Jiv90:  Cleavage induc  67.8     3.4 7.3E-05   29.3   1.5   15  100-114    56-70  (94)
 13 PF10717 ODV-E18:  Occlusion-de  59.7      12 0.00027   26.1   3.1   27   16-43     20-46  (85)
 14 PHA02681 ORF089 virion membran  52.3      42  0.0009   23.7   4.7   18   76-93     44-61  (92)
 15 PHA03049 IMV membrane protein;  50.7      32 0.00069   23.2   3.8   23   22-44      4-26  (68)
 16 PF15361 RIC3:  Resistance to i  48.5      46   0.001   25.0   4.8   21   23-43     88-108 (152)
 17 PF04689 S1FA:  DNA binding pro  48.2       4 8.7E-05   27.4  -0.8   20   15-34      7-26  (69)
 18 PF12273 RCR:  Chitin synthesis  47.7      10 0.00022   27.1   1.2   13   23-35      4-16  (130)
 19 PF05961 Chordopox_A13L:  Chord  46.8      44 0.00096   22.5   4.0   23   22-44      4-26  (68)
 20 PF06522 B12D:  NADH-ubiquinone  46.6      33  0.0007   22.6   3.4   31   17-47      5-35  (73)
 21 PRK13453 F0F1 ATP synthase sub  45.7      24 0.00052   26.4   2.9   32   12-43     10-41  (173)
 22 PF10875 DUF2670:  Protein of u  44.4      34 0.00074   25.7   3.5   37    4-40      1-44  (139)
 23 PF15086 UPF0542:  Uncharacteri  41.0      77  0.0017   21.6   4.5   36    6-41      5-40  (74)
 24 PF04272 Phospholamban:  Phosph  40.5      43 0.00093   21.2   3.0   19   20-38     32-50  (52)
 25 PF02009 Rifin_STEVOR:  Rifin/s  40.4      25 0.00054   29.3   2.5   21   18-38    260-280 (299)
 26 PRK08476 F0F1 ATP synthase sub  40.3      31 0.00067   25.1   2.7   28   17-44      4-31  (141)
 27 PF06024 DUF912:  Nucleopolyhed  40.3      10 0.00023   26.4   0.2   17   21-37     69-85  (101)
 28 PRK04561 tatA twin arginine tr  40.0      33 0.00072   23.4   2.6   18   17-34      3-20  (75)
 29 PF04277 OAD_gamma:  Oxaloaceta  39.5      68  0.0015   20.6   4.0   27   18-44     10-36  (79)
 30 PRK14750 kdpF potassium-transp  37.1      81  0.0018   17.9   3.5   25   19-43      2-26  (29)
 31 PRK02958 tatA twin arginine tr  36.9      39 0.00085   22.8   2.6   18   17-34      3-20  (73)
 32 PRK00720 tatA twin arginine tr  36.3      41 0.00089   23.0   2.7   18   17-34      3-20  (78)
 33 PRK04598 tatA twin arginine tr  36.1      41 0.00089   23.2   2.6   18   17-34      3-20  (81)
 34 PF10419 TFIIIC_sub6:  TFIIIC s  35.6      55  0.0012   18.9   2.8   22   91-113     2-23  (35)
 35 PF06078 DUF937:  Bacterial pro  35.5      77  0.0017   22.6   4.2   28    6-33    102-129 (137)
 36 PRK03814 oxaloacetate decarbox  33.9 1.1E+02  0.0023   21.0   4.4   27   18-44     17-43  (85)
 37 PF11662 DUF3263:  Protein of u  33.6      62  0.0014   22.1   3.2   22    9-30     25-46  (77)
 38 PF07172 GRP:  Glycine rich pro  33.5      47   0.001   23.1   2.7   17   24-40      6-22  (95)
 39 PRK03554 tatA twin arginine tr  33.2      48   0.001   23.4   2.6   18   17-34      3-20  (89)
 40 PF13068 DUF3932:  Protein of u  32.8      32 0.00068   23.5   1.6   15    5-19     32-46  (81)
 41 cd00565 ThiS ThiaminS ubiquiti  32.6      69  0.0015   19.9   3.1   27   83-110    14-40  (65)
 42 PRK14473 F0F1 ATP synthase sub  32.3      43 0.00093   24.6   2.4   25   17-41      5-29  (164)
 43 PRK10781 rcsF outer membrane l  32.3      64  0.0014   24.1   3.4   16   80-95     48-64  (133)
 44 PRK14748 kdpF potassium-transp  32.3   1E+02  0.0022   17.5   3.4   25   19-43      2-26  (29)
 45 PF01102 Glycophorin_A:  Glycop  32.2      62  0.0013   23.7   3.2   23   21-43     72-94  (122)
 46 PRK01833 tatA twin arginine tr  32.0      53  0.0012   22.2   2.6   18   17-34      3-20  (74)
 47 PLN02822 serine palmitoyltrans  31.6 1.7E+02  0.0037   25.3   6.3   23   22-44     38-60  (481)
 48 PRK01470 tatA twin arginine tr  31.0      55  0.0012   20.6   2.4   17   17-33      2-18  (51)
 49 TIGR01294 P_lamban phospholamb  30.8      73  0.0016   20.1   2.9   19   20-38     32-50  (52)
 50 PF05480 Staph_haemo:  Staphylo  30.6 1.3E+02  0.0029   18.4   5.4   25    1-25      1-25  (43)
 51 TIGR00822 EII-Sor PTS system,   30.5      95  0.0021   25.5   4.4   25   11-35    214-238 (265)
 52 COG4880 Secreted protein conta  30.2      53  0.0012   29.8   3.0   32   79-114    96-127 (603)
 53 TIGR01683 thiS thiamine biosyn  29.5      95  0.0021   19.2   3.4   27   83-110    13-39  (64)
 54 PRK03625 tatE twin arginine tr  28.8      59  0.0013   21.6   2.4   18   17-34      3-20  (67)
 55 PF06743 FAST_1:  FAST kinase-l  28.8 1.6E+02  0.0035   18.8   4.6   32    2-33     19-51  (71)
 56 PRK06488 sulfur carrier protei  28.7      81  0.0018   19.6   3.0   28   83-111    14-41  (65)
 57 PF10661 EssA:  WXG100 protein   28.7      61  0.0013   24.2   2.7   16   26-41    129-144 (145)
 58 PRK01614 tatE twin arginine tr  28.5      63  0.0014   22.6   2.6   18   17-34      3-20  (85)
 59 PF10411 DsbC_N:  Disulfide bon  28.3      58  0.0013   20.2   2.2   17   98-116    41-57  (57)
 60 PRK09174 F0F1 ATP synthase sub  28.0      45 0.00098   26.0   2.0   24   21-44     54-77  (204)
 61 PTZ00046 rifin; Provisional     27.6      94   0.002   26.8   4.0   21   18-38    319-339 (358)
 62 TIGR01477 RIFIN variant surfac  27.6      71  0.0015   27.5   3.3   21   18-38    314-334 (353)
 63 TIGR01411 tatAE twin arginine-  27.5      70  0.0015   19.5   2.4   17   17-33      1-17  (47)
 64 PRK08053 sulfur carrier protei  26.9 1.2E+02  0.0026   19.0   3.6   27   83-110    15-41  (66)
 65 COG5336 Uncharacterized protei  26.8 1.1E+02  0.0025   22.4   3.8   16   12-27     66-81  (116)
 66 PF06570 DUF1129:  Protein of u  26.4      92   0.002   23.8   3.5   26   17-42    177-202 (206)
 67 PRK13461 F0F1 ATP synthase sub  25.4      76  0.0017   23.1   2.7   24   18-41      3-26  (159)
 68 PHA02902 putative IMV membrane  24.8 2.2E+02  0.0049   19.1   4.8   17   76-92     46-62  (70)
 69 COG2028 Uncharacterized conser  24.7      57  0.0012   24.6   1.9   24   83-106    79-109 (145)
 70 cd01789 Alp11_N Ubiquitin-like  24.6      51  0.0011   21.8   1.6   19    5-23     25-43  (84)
 71 PRK05659 sulfur carrier protei  24.3 1.4E+02   0.003   18.3   3.4   28   83-111    15-42  (66)
 72 PRK07696 sulfur carrier protei  24.1 1.2E+02  0.0025   19.3   3.1   26   84-110    17-42  (67)
 73 PRK14859 tatA twin arginine tr  23.9      90  0.0019   20.4   2.6   18   17-34      3-20  (63)
 74 PHA00736 hypothetical protein   23.6 1.3E+02  0.0028   20.5   3.3   29   12-40      7-36  (79)
 75 PRK14472 F0F1 ATP synthase sub  23.4      82  0.0018   23.4   2.6   26   16-41     14-39  (175)
 76 PRK13454 F0F1 ATP synthase sub  23.2      71  0.0015   24.1   2.3   23   22-44     33-55  (181)
 77 PRK00191 tatA twin arginine tr  23.1      92   0.002   21.6   2.6   18   17-34      2-19  (84)
 78 PRK07440 hypothetical protein;  23.0 1.6E+02  0.0034   19.0   3.6   28   83-111    19-46  (70)
 79 TIGR03758 conj_TIGR03758 integ  22.6 2.1E+02  0.0046   18.9   4.2   26   10-35      6-31  (65)
 80 PF05279 Asp-B-Hydro_N:  Aspart  22.4   1E+02  0.0023   25.1   3.2   16   17-32      9-24  (243)
 81 smart00309 PAH Pancreatic horm  22.4      77  0.0017   18.7   1.8   12   82-93     10-21  (36)
 82 PRK06083 sulfur carrier protei  22.1 1.5E+02  0.0033   20.0   3.5   28   83-111    33-60  (84)
 83 PRK00442 tatA twin arginine tr  21.4      99  0.0022   21.8   2.5   18   17-34      3-20  (92)
 84 COG2104 ThiS Sulfur transfer p  21.4 1.3E+02  0.0027   19.7   2.9   27   84-111    18-44  (68)
 85 PF05132 RNA_pol_Rpc4:  RNA pol  21.3 1.1E+02  0.0024   21.9   2.9   19   98-116    77-95  (131)
 86 COG4736 CcoQ Cbb3-type cytochr  20.7 2.5E+02  0.0055   18.2   4.4   29    5-38      3-31  (60)
 87 KOG0720 Molecular chaperone (D  20.6      59  0.0013   29.2   1.5   16   99-114   377-392 (490)
 88 PF11100 TrbE:  Conjugal transf  20.2      54  0.0012   21.9   0.9   36    5-40     24-59  (66)
 89 PF04033 DUF365:  Domain of unk  20.0      76  0.0017   22.7   1.7   24   83-106    41-71  (97)

No 1  
>KOG1110 consensus Putative steroid membrane receptor Hpr6.6/25-Dx [General function prediction only]
Probab=99.78  E-value=4.1e-19  Score=137.25  Aligned_cols=90  Identities=36%  Similarity=0.622  Sum_probs=66.0

Q ss_pred             hhCCChHHHHHHHHHHHHHHHHHHhhccCCC-CCcchhhhhhhhhHHHHHHhhhccCCCCCCCCCcccCCCCHHHHhhcc
Q 045369           15 YTGLSPAAFFTILALMCVVYKTVCSMFVDPE-PPEDLKNKLISSSAAASAATAANFSNQTVIPETVQLGEVTEHELRAYD   93 (117)
Q Consensus        15 ~tglsp~~~~tila~~~~vY~~v~~~f~~~~-~~~~~~~~~~~~~a~~~a~~~~~e~~~p~~~~p~~~~~fT~eeL~~yd   93 (117)
                      |+||+|..+++.++++++++.++...+..+. ....+.     +       .....+.+|...+| +.++||.|||++||
T Consensus         1 ~~gl~~~~~~tpl~~al~~~~l~~~~kl~~~~~r~~~~-----~-------~~~~~~~~P~~~~P-~~~dfT~eEL~~yd   67 (183)
T KOG1110|consen    1 YVGLAPKVFFTPLALALLIFLLFVGLKLSRFKFRRDSE-----K-------SDGSTEEPPKESLP-KVRDFTVEELRQYD   67 (183)
T ss_pred             CCccchhhhhhhHHHHHHHHHHHhheeeeeeecccccc-----c-------cccCCCCCCccCCC-cccccCHHHHHhcC
Confidence            6789999999999999999999888876652 111110     0       01111121222233 34599999999999


Q ss_pred             CCCCCCCeEEEECCeEEEecCCCC
Q 045369           94 GSDPNKPLLMAIKGQIYDVSRSRH  117 (117)
Q Consensus        94 G~d~~~pi~lAi~G~VYDVt~gr~  117 (117)
                      |+++++||||||||+|||||+||+
T Consensus        68 Gs~~d~~Il~AI~G~VYDVT~Gr~   91 (183)
T KOG1110|consen   68 GSDPDKPILLAINGKVYDVTRGRE   91 (183)
T ss_pred             CCCCCCceEEEecceEEEecCCcc
Confidence            999999999999999999999985


No 2  
>KOG1108 consensus Predicted heme/steroid binding protein [General function prediction only]
Probab=99.22  E-value=6.7e-12  Score=101.36  Aligned_cols=82  Identities=23%  Similarity=0.401  Sum_probs=58.6

Q ss_pred             HHHHHHHHHHHHHHHHHhhccCCCCCcchhhhhhhhhHHHHHHhhhccCCCCCCCCCcccCCCCHHHHhhccCCCCCCCe
Q 045369           22 AFFTILALMCVVYKTVCSMFVDPEPPEDLKNKLISSSAAASAATAANFSNQTVIPETVQLGEVTEHELRAYDGSDPNKPL  101 (117)
Q Consensus        22 ~~~tila~~~~vY~~v~~~f~~~~~~~~~~~~~~~~~a~~~a~~~~~e~~~p~~~~p~~~~~fT~eeL~~ydG~d~~~pi  101 (117)
                      ..+.+.++...+|....+.|...+..+..++..      ..++.       |.....-....||+|||++|||+++++||
T Consensus        13 ~~~vvaa~~v~~~~sE~~~~l~~~t~n~~d~~~------~~~si-------pv~~~ag~k~lFtpeeLa~fnGt~e~~pi   79 (281)
T KOG1108|consen   13 FLFVVAAVLVGIYHTEIRQFLRRWTDNYLDQAW------QDASI-------PLAFQAGDKILFTPEELAKFNGTEEGRPI   79 (281)
T ss_pred             hhhhHHHHhhhhhhHHHHHHHHHHHhhccchhc------ccccc-------chhhhcCCceeeCHHHHhhccCCCCCCce
Confidence            345566777788888888887766665554311      00011       12222334458999999999999999999


Q ss_pred             EEEECCeEEEecCCC
Q 045369          102 LMAIKGQIYDVSRSR  116 (117)
Q Consensus       102 ~lAi~G~VYDVt~gr  116 (117)
                      |+||.|+|||||+|+
T Consensus        80 yLaiLGsVfdVs~gk   94 (281)
T KOG1108|consen   80 YLAILGSVFDVSRGK   94 (281)
T ss_pred             eeeeeceeeeccCCe
Confidence            999999999999997


No 3  
>COG4892 Predicted heme/steroid binding protein [General function prediction only]
Probab=99.17  E-value=2.2e-11  Score=82.91  Aligned_cols=33  Identities=42%  Similarity=0.758  Sum_probs=30.2

Q ss_pred             cCCCCHHHHhhccCCCCCCCeEEEECCeEEEecCC
Q 045369           81 LGEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSRS  115 (117)
Q Consensus        81 ~~~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~g  115 (117)
                      +|+||.|||++|||++ + |+|||++|+|||||.+
T Consensus         1 mrefTLEELs~ynG~n-G-paYiA~~G~VYDvS~s   33 (81)
T COG4892           1 MREFTLEELSKYNGEN-G-PAYIAVNGTVYDVSLS   33 (81)
T ss_pred             CceecHHHHHhhcCCC-C-CeEEEECCEEEeeccC
Confidence            4789999999999987 4 9999999999999975


No 4  
>PF00173 Cyt-b5:  Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry;  InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts []. The microsomal and mitochondrial variants are membrane-bound, while those from erythrocytes and other animal tissues are water-soluble [, ]. The 3D structure of bovine cyt b5 is known, the fold belonging to the alpha+beta class, with 5 strands and 5 short helices forming a framework for supporting a central haem group []. The cytochrome b5 domain is similar to that of a number of oxidoreductases, such as plant and fungal nitrate reductases, sulphite oxidase, yeast flavocytochrome b2 (L-lactate dehydrogenase) and plant cyt b5/acyl lipid desaturase fusion protein.; GO: 0020037 heme binding; PDB: 2I96_A 3KS0_A 1KBI_B 1KBJ_B 1LTD_A 1SZG_B 1SZF_A 1LDC_B 2OZ0_B 1LCO_A ....
Probab=98.22  E-value=6.9e-07  Score=57.61  Aligned_cols=29  Identities=28%  Similarity=0.371  Sum_probs=25.8

Q ss_pred             CCHHHHhhccCCCCCCCeEEEECCeEEEecCC
Q 045369           84 VTEHELRAYDGSDPNKPLLMAIKGQIYDVSRS  115 (117)
Q Consensus        84 fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~g  115 (117)
                      ||.+||+++|  + ++++|++|+|+|||||.-
T Consensus         2 ~t~~el~~h~--~-~~~~~v~i~g~VYDvt~~   30 (76)
T PF00173_consen    2 YTWEELAKHN--K-KGDCWVIIDGKVYDVTDF   30 (76)
T ss_dssp             EEHHHHTTTE--E-TTEEEEEETTEEEECTTT
T ss_pred             CCHHHHhhhC--C-CCCEEEEECCEEcccccc
Confidence            7899999999  3 558999999999999973


No 5  
>KOG0536 consensus Flavohemoprotein b5+b5R [Energy production and conversion]
Probab=97.89  E-value=1.2e-05  Score=60.58  Aligned_cols=29  Identities=34%  Similarity=0.617  Sum_probs=26.9

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEEEecC
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIYDVSR  114 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~  114 (117)
                      .+|.+||+++|-.|   .+|++|+|+|||||.
T Consensus        69 ~vt~~El~KH~~~d---DcW~~i~G~VYnVt~   97 (145)
T KOG0536|consen   69 PVTAEELKKHNKKD---DCWIAIRGKVYNVTA   97 (145)
T ss_pred             ccCHHHHHhhCCcc---ceEEEEcCEEEeccc
Confidence            68999999999988   399999999999995


No 6  
>COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism]
Probab=96.90  E-value=0.00095  Score=51.38  Aligned_cols=31  Identities=29%  Similarity=0.486  Sum_probs=27.7

Q ss_pred             CCCCHHHHhhccCCCCCCCeEEEECCeEEEecCC
Q 045369           82 GEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSRS  115 (117)
Q Consensus        82 ~~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~g  115 (117)
                      ..++.+|+.+++..+   .+||.|+|+|||||+-
T Consensus        50 ~~~~~eev~~h~~~~---d~~ivi~g~VyDvs~f   80 (164)
T COG5274          50 KPITAEEVAKHNKSE---DCWIVINGKVYDVSQF   80 (164)
T ss_pred             ccccHHHHHHhcCcc---ceEEEEcCEEEEhhhc
Confidence            469999999999987   3999999999999963


No 7  
>PLN03198 delta6-acyl-lipid desaturase; Provisional
Probab=96.38  E-value=0.0031  Score=55.51  Aligned_cols=32  Identities=25%  Similarity=0.320  Sum_probs=28.1

Q ss_pred             ccCCCCHHHHhhccCCCCCCCeEEEECCeEEEecC
Q 045369           80 QLGEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSR  114 (117)
Q Consensus        80 ~~~~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~  114 (117)
                      +.+.+|.+|++++|-.+   .+|+.|+|+|||||.
T Consensus       102 ~~~~~t~~ev~~H~~~~---d~Wivi~gkVYDvT~  133 (526)
T PLN03198        102 KSKSHLLSEVAAHNKPN---DCWIVIKNKVYDVSD  133 (526)
T ss_pred             ccCcCCHHHHHhhCCCC---CeEEEECCEEEecHH
Confidence            34589999999999876   599999999999984


No 8  
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=96.36  E-value=0.0036  Score=54.26  Aligned_cols=30  Identities=20%  Similarity=0.381  Sum_probs=26.9

Q ss_pred             CCCCHHHHhhccCCCCCCCeEEEECCeEEEecC
Q 045369           82 GEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSR  114 (117)
Q Consensus        82 ~~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~  114 (117)
                      +.||.+|+++++..+   .+|+.|+|+|||||+
T Consensus        24 ~~~s~~ev~~h~~~~---~~wi~i~g~vYDvt~   53 (485)
T PLN03199         24 QKISWQEVKKHASPD---DAWIIHQNKVYDVSN   53 (485)
T ss_pred             CccCHHHHHhhCCCC---CeEEEECCEEEcCCC
Confidence            569999999999866   589999999999995


No 9  
>PLN02252 nitrate reductase [NADPH]
Probab=95.73  E-value=0.012  Score=54.87  Aligned_cols=32  Identities=25%  Similarity=0.478  Sum_probs=28.1

Q ss_pred             ccCCCCHHHHhhccCCCCCCCeEEEECCeEEEecC
Q 045369           80 QLGEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSR  114 (117)
Q Consensus        80 ~~~~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~  114 (117)
                      ..+.||.+|+++++..+   .+|+.|+|+|||||.
T Consensus       516 ~~~~~t~~ev~~h~~~~---~~Wivi~g~VYDvT~  547 (888)
T PLN02252        516 GSKQYTMSEVRKHNSED---SCWIVVHGHVYDCTR  547 (888)
T ss_pred             ccceeCHHHHHhhCcCC---CeEEEECCEEEeCHH
Confidence            44789999999999865   599999999999984


No 10 
>KOG4576 consensus Sulfite oxidase, heme-binding component [Energy production and conversion]
Probab=90.03  E-value=0.24  Score=37.89  Aligned_cols=30  Identities=20%  Similarity=0.386  Sum_probs=26.4

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEEEecC
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIYDVSR  114 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~  114 (117)
                      .+|.||.++++-  +..+||+-++.-|||||.
T Consensus        81 iY~~EEV~~H~s--~e~rIWVTyg~gVyDVTd  110 (167)
T KOG4576|consen   81 IYTKEEVSSHTS--PETRIWVTYGSGVYDVTD  110 (167)
T ss_pred             chhHHHHHhcCC--CccceEEEecCcceeHHH
Confidence            599999999987  356899999999999984


No 11 
>KOG4232 consensus Delta 6-fatty acid desaturase/delta-8 sphingolipid desaturase [Lipid transport and metabolism]
Probab=74.47  E-value=1.4  Score=38.56  Aligned_cols=29  Identities=28%  Similarity=0.454  Sum_probs=25.5

Q ss_pred             CCCCHHHHhhccCCCCCCCeEEEECCeEEEecC
Q 045369           82 GEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSR  114 (117)
Q Consensus        82 ~~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~  114 (117)
                      +.+|-|+++++|+.+   ..|+.|.| |||+|.
T Consensus         8 ~~~~we~~~~~~~~~---~~W~~id~-vYd~s~   36 (430)
T KOG4232|consen    8 TTFSWEGKRKHDKAE---GLWLVIDG-VYDISD   36 (430)
T ss_pred             eeeeccchhhccCCC---ceEEEeec-cccHHH
Confidence            468889999999988   48999999 999984


No 12 
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=67.77  E-value=3.4  Score=29.32  Aligned_cols=15  Identities=20%  Similarity=0.702  Sum_probs=13.2

Q ss_pred             CeEEEECCeEEEecC
Q 045369          100 PLLMAIKGQIYDVSR  114 (117)
Q Consensus       100 pi~lAi~G~VYDVt~  114 (117)
                      ..|.-..|+|||+|.
T Consensus        56 ~yy~c~~g~VyDiTe   70 (94)
T PF14901_consen   56 TYYACMDGKVYDITE   70 (94)
T ss_pred             EEEEEcCceEEehhh
Confidence            578889999999995


No 13 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=59.70  E-value=12  Score=26.11  Aligned_cols=27  Identities=26%  Similarity=0.629  Sum_probs=19.3

Q ss_pred             hCCChHHHHHHHHHHHHHHHHHHhhccC
Q 045369           16 TGLSPAAFFTILALMCVVYKTVCSMFVD   43 (117)
Q Consensus        16 tglsp~~~~tila~~~~vY~~v~~~f~~   43 (117)
                      .|++|-.+.+|+++++.+..++- +|..
T Consensus        20 ~~l~pn~lMtILivLVIIiLlIm-lfqs   46 (85)
T PF10717_consen   20 NGLNPNTLMTILIVLVIIILLIM-LFQS   46 (85)
T ss_pred             cccChhHHHHHHHHHHHHHHHHH-HHhc
Confidence            57899999998887776665544 4543


No 14 
>PHA02681 ORF089 virion membrane protein; Provisional
Probab=52.34  E-value=42  Score=23.69  Aligned_cols=18  Identities=17%  Similarity=0.337  Sum_probs=13.5

Q ss_pred             CCCcccCCCCHHHHhhcc
Q 045369           76 PETVQLGEVTEHELRAYD   93 (117)
Q Consensus        76 ~~p~~~~~fT~eeL~~yd   93 (117)
                      ..++-...+|++|.+.|-
T Consensus        44 ~ds~F~D~lTpDQVrAlH   61 (92)
T PHA02681         44 GASSFEDKMTDDQVRAFH   61 (92)
T ss_pred             CCchhhccCCHHHHHHHH
Confidence            455656789999998775


No 15 
>PHA03049 IMV membrane protein; Provisional
Probab=50.69  E-value=32  Score=23.16  Aligned_cols=23  Identities=4%  Similarity=0.200  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhccCC
Q 045369           22 AFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        22 ~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      .+++++++++++-.++++++.+.
T Consensus         4 d~~l~iICVaIi~lIvYgiYnkk   26 (68)
T PHA03049          4 DIILVIICVVIIGLIVYGIYNKK   26 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcc
Confidence            34556666666677777777543


No 16 
>PF15361 RIC3:  Resistance to inhibitors of cholinesterase homologue 3
Probab=48.49  E-value=46  Score=25.00  Aligned_cols=21  Identities=14%  Similarity=0.213  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHhhccC
Q 045369           23 FFTILALMCVVYKTVCSMFVD   43 (117)
Q Consensus        23 ~~tila~~~~vY~~v~~~f~~   43 (117)
                      +.||.++++++|.+++..+..
T Consensus        88 lYtiGI~~f~lY~l~Ki~~~k  108 (152)
T PF15361_consen   88 LYTIGIVLFILYTLFKIKKKK  108 (152)
T ss_pred             HHHHHHHHHHHHHHHHHHhcC
Confidence            467788888888887766443


No 17 
>PF04689 S1FA:  DNA binding protein S1FA;  InterPro: IPR006779  S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=48.22  E-value=4  Score=27.42  Aligned_cols=20  Identities=15%  Similarity=0.286  Sum_probs=12.2

Q ss_pred             hhCCChHHHHHHHHHHHHHH
Q 045369           15 YTGLSPAAFFTILALMCVVY   34 (117)
Q Consensus        15 ~tglsp~~~~tila~~~~vY   34 (117)
                      -.||+|..++++++.-+++.
T Consensus         7 ~KGlnPGlIVLlvV~g~ll~   26 (69)
T PF04689_consen    7 AKGLNPGLIVLLVVAGLLLV   26 (69)
T ss_pred             ccCCCCCeEEeehHHHHHHH
Confidence            37999977666544433333


No 18 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=47.70  E-value=10  Score=27.12  Aligned_cols=13  Identities=15%  Similarity=0.570  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHHH
Q 045369           23 FFTILALMCVVYK   35 (117)
Q Consensus        23 ~~tila~~~~vY~   35 (117)
                      +|.|++++++++.
T Consensus         4 l~~iii~~i~l~~   16 (130)
T PF12273_consen    4 LFAIIIVAILLFL   16 (130)
T ss_pred             eHHHHHHHHHHHH
Confidence            4444333333333


No 19 
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=46.76  E-value=44  Score=22.47  Aligned_cols=23  Identities=9%  Similarity=0.272  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHHhhccCC
Q 045369           22 AFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        22 ~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      .+++++++++++-.++++++.+.
T Consensus         4 d~iLi~ICVaii~lIlY~iYnr~   26 (68)
T PF05961_consen    4 DFILIIICVAIIGLILYGIYNRK   26 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcc
Confidence            45666666667777777776543


No 20 
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=46.63  E-value=33  Score=22.61  Aligned_cols=31  Identities=13%  Similarity=0.147  Sum_probs=25.7

Q ss_pred             CCChHHHHHHHHHHHHHHHHHHhhccCCCCC
Q 045369           17 GLSPAAFFTILALMCVVYKTVCSMFVDPEPP   47 (117)
Q Consensus        17 glsp~~~~tila~~~~vY~~v~~~f~~~~~~   47 (117)
                      .+-|.-++..+++..++|++++.++..|+-.
T Consensus         5 el~PL~~~vg~a~~~a~~~~~r~l~~~PdV~   35 (73)
T PF06522_consen    5 ELYPLFVIVGVAVGGATFYLYRLLLTNPDVR   35 (73)
T ss_pred             cccchHHHHHHHHHHHHHHHHHHHhcCCCeE
Confidence            3568888889999999999999998887543


No 21 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=45.69  E-value=24  Score=26.41  Aligned_cols=32  Identities=6%  Similarity=0.027  Sum_probs=20.4

Q ss_pred             HHHhhCCChHHHHHHHHHHHHHHHHHHhhccC
Q 045369           12 VTTYTGLSPAAFFTILALMCVVYKTVCSMFVD   43 (117)
Q Consensus        12 i~~~tglsp~~~~tila~~~~vY~~v~~~f~~   43 (117)
                      +-+..|++++++|..++..++++.+++.++-+
T Consensus        10 ~~~~~~~~~~t~~~~iInFliL~~lL~~~l~~   41 (173)
T PRK13453         10 LGAAGGVEWGTVIVTVLTFIVLLALLKKFAWG   41 (173)
T ss_pred             HHhhcCCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45667888888776655555555555555433


No 22 
>PF10875 DUF2670:  Protein of unknown function (DUF2670);  InterPro: IPR022714  This bacterial family of proteins has no known function and appears to be restricted to Rickettsiaceae. 
Probab=44.42  E-value=34  Score=25.72  Aligned_cols=37  Identities=19%  Similarity=0.288  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHh-hCCChHHHHH------HHHHHHHHHHHHHhh
Q 045369            4 FFAAVMDTVTTY-TGLSPAAFFT------ILALMCVVYKTVCSM   40 (117)
Q Consensus         4 ~~~~~~~~i~~~-tglsp~~~~t------ila~~~~vY~~v~~~   40 (117)
                      .|++++.-|.+- .|+-++++++      .++-++.+||++.++
T Consensus         1 mwqalrrlIaaNPMg~flw~iItKWyL~IavaSlI~lyy~v~gl   44 (139)
T PF10875_consen    1 MWQALRRLIAANPMGFFLWSIITKWYLIIAVASLITLYYTVLGL   44 (139)
T ss_pred             ChHHHHHHHhhCCchhhHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            399999988762 2333333333      356678899998877


No 23 
>PF15086 UPF0542:  Uncharacterised protein family UPF0542
Probab=41.01  E-value=77  Score=21.64  Aligned_cols=36  Identities=14%  Similarity=0.255  Sum_probs=27.9

Q ss_pred             HHHHHHHHHhhCCChHHHHHHHHHHHHHHHHHHhhc
Q 045369            6 AAVMDTVTTYTGLSPAAFFTILALMCVVYKTVCSMF   41 (117)
Q Consensus         6 ~~~~~~i~~~tglsp~~~~tila~~~~vY~~v~~~f   41 (117)
                      ..-.+.++-|--=+|..|++.+++++.=.++++..+
T Consensus         5 k~w~~~~v~~vAkdP~~Fl~~vll~LtPlfiisa~l   40 (74)
T PF15086_consen    5 KAWASYIVEWVAKDPYEFLTTVLLILTPLFIISAVL   40 (74)
T ss_pred             HHHHHHHHHHHHcChHHHHHHHHHHHhHHHHHHHHH
Confidence            344466677777899999998888887777777776


No 24 
>PF04272 Phospholamban:  Phospholamban;  InterPro: IPR005984  Phospholamban (PLB) is a small protein (52 amino acids) that regulates the affinity of the cardiac sarcoplasmic reticulum Ca2+-ATPase (SERCA2a) for calcium. PLB is present in cardiac myocytes, in slow-twitch and smooth muscle and is expressed also in aorta endothelial cells in which it could play a role in tissue relaxation. The phosphorylation/dephosphorylation of phospholamban removes and restores, respectively, its inhibitory activity on SERCA2a. It has in fact been shown that phospholamban, in its non-phosphorylated form, binds to SERCA2a and inhibits this pump by lowering its affinity for Ca2+, whereas the phosphorylated form does not exert the inhibition. PLB is phosphorylated at two sites, namely at Ser-16 for a cAMP-dependent phosphokinase and at Thr-17 for a Ca2+/calmodulin-dependent phosphokinase, phosphorylation at Ser-16 being a prerequisite for the phosphorylation at Thr-17.   The structure of a 36-amino-acid-long N-terminal fragment of human phospholamban phosphorylated at Ser-16 and Thr-17 and Cys36Ser mutated was determined from nuclear magnetic resonance data. The peptide assumes a conformation characterised by two alpha-helices connected by an irregular strand, which comprises the amino acids from Arg-13 to Pro-21. The proline is in a trans conformation. The two phosphate groups on Ser-16 and Thr-17 are shown to interact preferably with the side chains of Arg-14 and Arg-13, respectively [].; GO: 0005246 calcium channel regulator activity, 0042030 ATPase inhibitor activity, 0006816 calcium ion transport, 0016020 membrane; PDB: 1N7L_A 1FJP_A 1FJK_A 2HYN_C 1ZLL_D 1PLP_A 3O7L_I.
Probab=40.46  E-value=43  Score=21.17  Aligned_cols=19  Identities=21%  Similarity=0.214  Sum_probs=15.0

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q 045369           20 PAAFFTILALMCVVYKTVC   38 (117)
Q Consensus        20 p~~~~tila~~~~vY~~v~   38 (117)
                      ..+|.+|+++++++|.++-
T Consensus        32 fvnfclilicllli~iiv~   50 (52)
T PF04272_consen   32 FVNFCLILICLLLICIIVM   50 (52)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4678888888888887763


No 25 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=40.41  E-value=25  Score=29.32  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=17.0

Q ss_pred             CChHHHHHHHHHHHHHHHHHH
Q 045369           18 LSPAAFFTILALMCVVYKTVC   38 (117)
Q Consensus        18 lsp~~~~tila~~~~vY~~v~   38 (117)
                      .|-.+++.|+++++.+|++++
T Consensus       260 aSiiaIliIVLIMvIIYLILR  280 (299)
T PF02009_consen  260 ASIIAILIIVLIMVIIYLILR  280 (299)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            456777788888999999987


No 26 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=40.32  E-value=31  Score=25.11  Aligned_cols=28  Identities=11%  Similarity=0.304  Sum_probs=17.1

Q ss_pred             CCChHHHHHHHHHHHHHHHHHHhhccCC
Q 045369           17 GLSPAAFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        17 glsp~~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      ++++++|+..++..+++|.+++.++-+|
T Consensus         4 ~l~~~~~~~qli~Flil~~~l~kfl~kP   31 (141)
T PRK08476          4 DVNPYLMLATFVVFLLLIVILNSWLYKP   31 (141)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5677776666666666666666655443


No 27 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=40.31  E-value=10  Score=26.42  Aligned_cols=17  Identities=29%  Similarity=0.585  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 045369           21 AAFFTILALMCVVYKTV   37 (117)
Q Consensus        21 ~~~~tila~~~~vY~~v   37 (117)
                      .++|.++++++++||++
T Consensus        69 ls~v~IlVily~IyYFV   85 (101)
T PF06024_consen   69 LSFVCILVILYAIYYFV   85 (101)
T ss_pred             HHHHHHHHHHhhheEEE
Confidence            34555555555555443


No 28 
>PRK04561 tatA twin arginine translocase protein A; Provisional
Probab=39.97  E-value=33  Score=23.44  Aligned_cols=18  Identities=17%  Similarity=0.438  Sum_probs=12.2

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |+||+-++.|++++++++
T Consensus         3 g~s~~ellIIlvIvlLlF   20 (75)
T PRK04561          3 SFSIWHWLVVLVIVLLVF   20 (75)
T ss_pred             CCcHHHHHHHHHHHHHHh
Confidence            678887777766665543


No 29 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=39.46  E-value=68  Score=20.62  Aligned_cols=27  Identities=15%  Similarity=0.272  Sum_probs=20.5

Q ss_pred             CChHHHHHHHHHHHHHHHHHHhhccCC
Q 045369           18 LSPAAFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        18 lsp~~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      +.....|++|+++.++..++++++...
T Consensus        10 ~Gm~iVF~~L~lL~~~i~l~~~~~~~~   36 (79)
T PF04277_consen   10 IGMGIVFLVLILLILVISLMSKLIRKF   36 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            446778888888888888888886443


No 30 
>PRK14750 kdpF potassium-transporting ATPase subunit F; Provisional
Probab=37.15  E-value=81  Score=17.94  Aligned_cols=25  Identities=12%  Similarity=0.111  Sum_probs=16.3

Q ss_pred             ChHHHHHHHHHHHHHHHHHHhhccC
Q 045369           19 SPAAFFTILALMCVVYKTVCSMFVD   43 (117)
Q Consensus        19 sp~~~~tila~~~~vY~~v~~~f~~   43 (117)
                      |...+..++++++++-|+++.+|..
T Consensus         2 s~~vi~g~llv~lLl~YLvYAL~na   26 (29)
T PRK14750          2 NFSIVCGALLVLLLLGYLVYALFNA   26 (29)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHcCc
Confidence            3344555677777777788877754


No 31 
>PRK02958 tatA twin arginine translocase protein A; Provisional
Probab=36.87  E-value=39  Score=22.80  Aligned_cols=18  Identities=17%  Similarity=0.455  Sum_probs=12.5

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++|+-++.|++++++++
T Consensus         3 ~~g~~elliIl~IvlllF   20 (73)
T PRK02958          3 SFSIWHWLIVLVIVVLVF   20 (73)
T ss_pred             CccHHHHHHHHHHHHHHh
Confidence            578887777776666554


No 32 
>PRK00720 tatA twin arginine translocase protein A; Provisional
Probab=36.33  E-value=41  Score=23.04  Aligned_cols=18  Identities=17%  Similarity=0.421  Sum_probs=12.6

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 g~g~~ellIIlvIvlllF   20 (78)
T PRK00720          3 SFSIWHWLIVLAVVLLLF   20 (78)
T ss_pred             CCcHHHHHHHHHHHHHHh
Confidence            678887777766666655


No 33 
>PRK04598 tatA twin arginine translocase protein A; Provisional
Probab=36.08  E-value=41  Score=23.18  Aligned_cols=18  Identities=17%  Similarity=0.456  Sum_probs=12.3

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 glg~~elliIlvivlllF   20 (81)
T PRK04598          3 GISIWQLLIIAVIVVLLF   20 (81)
T ss_pred             CccHHHHHHHHHHHHHHh
Confidence            678887777766666554


No 34 
>PF10419 TFIIIC_sub6:  TFIIIC subunit;  InterPro: IPR019481  This conserved domain is found in a family of proteins that function as subunits of transcription factor IIIC (TFIIIC) []. TFIIIC in yeast and humans is required for transcription of tRNA and 5 S RNA genes by RNA polymerase III. The yeast proteins in this entry are fused to phosphoglycerate mutase domain. 
Probab=35.65  E-value=55  Score=18.93  Aligned_cols=22  Identities=23%  Similarity=0.499  Sum_probs=16.8

Q ss_pred             hccCCCCCCCeEEEECCeEEEec
Q 045369           91 AYDGSDPNKPLLMAIKGQIYDVS  113 (117)
Q Consensus        91 ~ydG~d~~~pi~lAi~G~VYDVt  113 (117)
                      |.-|-|...|+ +.|+++||--+
T Consensus         2 qi~gLdt~~Pi-l~i~~~vf~G~   23 (35)
T PF10419_consen    2 QILGLDTENPI-LQIGNQVFEGE   23 (35)
T ss_pred             EEeccCCCCCE-EEECCEEEEEE
Confidence            34567777788 99999999654


No 35 
>PF06078 DUF937:  Bacterial protein of unknown function (DUF937);  InterPro: IPR009282 This entry consists of several hypothetical bacterial proteins of unknown function.; PDB: 1Z67_A.
Probab=35.51  E-value=77  Score=22.59  Aligned_cols=28  Identities=29%  Similarity=0.465  Sum_probs=21.9

Q ss_pred             HHHHHHHHHhhCCChHHHHHHHHHHHHH
Q 045369            6 AAVMDTVTTYTGLSPAAFFTILALMCVV   33 (117)
Q Consensus         6 ~~~~~~i~~~tglsp~~~~tila~~~~v   33 (117)
                      +.+.+.|..+||+++-....+++.++.+
T Consensus       102 ~~~~~~lA~~tGl~~~~~~~lL~~~lP~  129 (137)
T PF06078_consen  102 DDVIQQLAQQTGLSPDSAQQLLAMLLPL  129 (137)
T ss_dssp             HHHHHHHHHHHT--HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCcCHHHHHHHHHHHHHH
Confidence            5688999999999999998888877654


No 36 
>PRK03814 oxaloacetate decarboxylase subunit gamma; Provisional
Probab=33.90  E-value=1.1e+02  Score=21.05  Aligned_cols=27  Identities=11%  Similarity=0.251  Sum_probs=21.7

Q ss_pred             CChHHHHHHHHHHHHHHHHHHhhccCC
Q 045369           18 LSPAAFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        18 lsp~~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      +-...+|.++.+++.+.+++++.|..+
T Consensus        17 ~GM~~VF~fL~lLi~~~~l~~~~~~~~   43 (85)
T PRK03814         17 TGMGVVFIFLTLLVYLVQLMSKLIPQE   43 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCCC
Confidence            447788888899999999999998543


No 37 
>PF11662 DUF3263:  Protein of unknown function (DUF3263);  InterPro: IPR021678  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=33.58  E-value=62  Score=22.06  Aligned_cols=22  Identities=23%  Similarity=0.496  Sum_probs=16.8

Q ss_pred             HHHHHHhhCCChHHHHHHHHHH
Q 045369            9 MDTVTTYTGLSPAAFFTILALM   30 (117)
Q Consensus         9 ~~~i~~~tglsp~~~~tila~~   30 (117)
                      -++|..-.||||...+-.|..+
T Consensus        25 e~aIre~fGls~~rYyq~Ln~L   46 (77)
T PF11662_consen   25 EEAIREEFGLSPTRYYQRLNAL   46 (77)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHH
Confidence            3789999999998877665443


No 38 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=33.45  E-value=47  Score=23.14  Aligned_cols=17  Identities=24%  Similarity=0.364  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHHHHhh
Q 045369           24 FTILALMCVVYKTVCSM   40 (117)
Q Consensus        24 ~tila~~~~vY~~v~~~   40 (117)
                      |++|++++++.+++++-
T Consensus         6 ~llL~l~LA~lLlisSe   22 (95)
T PF07172_consen    6 FLLLGLLLAALLLISSE   22 (95)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            56666677777777644


No 39 
>PRK03554 tatA twin arginine translocase protein A; Provisional
Probab=33.24  E-value=48  Score=23.36  Aligned_cols=18  Identities=17%  Similarity=0.456  Sum_probs=12.5

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 glG~~eLlIIlvIvLLlF   20 (89)
T PRK03554          3 GISIWQLLIIAVIVVLLF   20 (89)
T ss_pred             CccHHHHHHHHHHHHHHh
Confidence            677877777766666654


No 40 
>PF13068 DUF3932:  Protein of unknown function (DUF3932)
Probab=32.76  E-value=32  Score=23.46  Aligned_cols=15  Identities=13%  Similarity=0.361  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHhhCCC
Q 045369            5 FAAVMDTVTTYTGLS   19 (117)
Q Consensus         5 ~~~~~~~i~~~tgls   19 (117)
                      |.++||-|..||-.-
T Consensus        32 wttlkeliheytt~h   46 (81)
T PF13068_consen   32 WTTLKELIHEYTTSH   46 (81)
T ss_pred             hhHHHHHHHHHhccc
Confidence            999999999999765


No 41 
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein. ThiS (ThiaminS) is a sulfur carrier protein involved in thiamin biosynthesis in bacteria.  The ThiS fold, like those of two closely related proteins MoaD and Urm1, is similar to that of ubiquitin although there is little or no sequence similarity.
Probab=32.59  E-value=69  Score=19.89  Aligned_cols=27  Identities=30%  Similarity=0.319  Sum_probs=22.1

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEE
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIY  110 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VY  110 (117)
                      ..|..+|.++-|-+ ...|-++++|++-
T Consensus        14 ~~tv~~ll~~l~~~-~~~i~V~vNg~~v   40 (65)
T cd00565          14 GATLAELLEELGLD-PRGVAVALNGEIV   40 (65)
T ss_pred             CCCHHHHHHHcCCC-CCcEEEEECCEEc
Confidence            46788998888877 5679999999984


No 42 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=32.32  E-value=43  Score=24.55  Aligned_cols=25  Identities=8%  Similarity=0.166  Sum_probs=13.7

Q ss_pred             CCChHHHHHHHHHHHHHHHHHHhhc
Q 045369           17 GLSPAAFFTILALMCVVYKTVCSMF   41 (117)
Q Consensus        17 glsp~~~~tila~~~~vY~~v~~~f   41 (117)
                      |++++.|+..++..++++.++..++
T Consensus         5 ~~~~~~~~~~~inflil~~lL~~fl   29 (164)
T PRK14473          5 GINLGLLIAQLINFLLLIFLLRTFL   29 (164)
T ss_pred             cCcHHHHHHHHHHHHHHHHHHHHHH
Confidence            6777776665444444444444444


No 43 
>PRK10781 rcsF outer membrane lipoprotein; Reviewed
Probab=32.31  E-value=64  Score=24.10  Aligned_cols=16  Identities=19%  Similarity=-0.049  Sum_probs=11.7

Q ss_pred             ccCCCC-HHHHhhccCC
Q 045369           80 QLGEVT-EHELRAYDGS   95 (117)
Q Consensus        80 ~~~~fT-~eeL~~ydG~   95 (117)
                      ..+.|+ .|||..++=+
T Consensus        48 ~V~lY~~~eel~~~~~~   64 (133)
T PRK10781         48 PVRLYTNAEELVGKPFR   64 (133)
T ss_pred             ceEEEcCHHHHcCCCCc
Confidence            346799 5999888743


No 44 
>PRK14748 kdpF potassium-transporting ATPase subunit F; Provisional
Probab=32.30  E-value=1e+02  Score=17.55  Aligned_cols=25  Identities=12%  Similarity=0.137  Sum_probs=15.3

Q ss_pred             ChHHHHHHHHHHHHHHHHHHhhccC
Q 045369           19 SPAAFFTILALMCVVYKTVCSMFVD   43 (117)
Q Consensus        19 sp~~~~tila~~~~vY~~v~~~f~~   43 (117)
                      |-..+..++++++++-|++.-++.+
T Consensus         2 s~~vi~G~ilv~lLlgYLvyALi~a   26 (29)
T PRK14748          2 SAGVITGVLLVFLLLGYLVYALINA   26 (29)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHhCc
Confidence            4455666666666666667666643


No 45 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=32.15  E-value=62  Score=23.73  Aligned_cols=23  Identities=0%  Similarity=0.125  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccC
Q 045369           21 AAFFTILALMCVVYKTVCSMFVD   43 (117)
Q Consensus        21 ~~~~tila~~~~vY~~v~~~f~~   43 (117)
                      ..|+.++++.++++|+++++-..
T Consensus        72 gv~aGvIg~Illi~y~irR~~Kk   94 (122)
T PF01102_consen   72 GVMAGVIGIILLISYCIRRLRKK   94 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHS--
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcc
Confidence            45566666777777887777654


No 46 
>PRK01833 tatA twin arginine translocase protein A; Provisional
Probab=31.97  E-value=53  Score=22.22  Aligned_cols=18  Identities=22%  Similarity=0.571  Sum_probs=12.3

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 g~g~~elliIl~i~lllF   20 (74)
T PRK01833          3 GISIWQLLIIVAIIVLLF   20 (74)
T ss_pred             CccHHHHHHHHHHHHHHh
Confidence            678887777766665554


No 47 
>PLN02822 serine palmitoyltransferase
Probab=31.60  E-value=1.7e+02  Score=25.26  Aligned_cols=23  Identities=13%  Similarity=0.225  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhccCC
Q 045369           22 AFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        22 ~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      .++=++++++++|++.++-+..+
T Consensus        38 ~~~e~~l~~~~~~~~~~~~~~~~   60 (481)
T PLN02822         38 LVVEGLLIVVIVFLLSQKSYKPP   60 (481)
T ss_pred             hHHHHHHHHHHHHHHHcCcCCCC
Confidence            45557888889999988887654


No 48 
>PRK01470 tatA twin arginine translocase protein A; Provisional
Probab=31.01  E-value=55  Score=20.59  Aligned_cols=17  Identities=24%  Similarity=0.532  Sum_probs=11.3

Q ss_pred             CCChHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVV   33 (117)
Q Consensus        17 glsp~~~~tila~~~~v   33 (117)
                      |++++-++.|+++++++
T Consensus         2 gig~~elliI~vi~llv   18 (51)
T PRK01470          2 GMSFSHLLIVLLIIFVL   18 (51)
T ss_pred             CCCHHHHHHHHHHHHHh
Confidence            67787777666665554


No 49 
>TIGR01294 P_lamban phospholamban. This model represents the short (52 residue) transmembrane phosphoprotein phospholamban. Phospholamban, in its unphosphorylated form, inhibits SERCA2, the cardiac sarcoplasmic reticulum Ca-ATPase.
Probab=30.81  E-value=73  Score=20.13  Aligned_cols=19  Identities=21%  Similarity=0.198  Sum_probs=14.4

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q 045369           20 PAAFFTILALMCVVYKTVC   38 (117)
Q Consensus        20 p~~~~tila~~~~vY~~v~   38 (117)
                      ..+|.+|+++++++|.++-
T Consensus        32 fvnf~lilicllli~iivm   50 (52)
T TIGR01294        32 FINFCLILICLLLICIIVM   50 (52)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4677888888888887763


No 50 
>PF05480 Staph_haemo:  Staphylococcus haemolytic protein;  InterPro: IPR008846 This family consists of several different short Staphylococcal proteins, it contains SLUSH A, B and C proteins as well as haemolysin and gonococcal growth inhibitor. Some strains of the coagulase-negative Staphylococcus lugdunensis produce a synergistic hemolytic activity (SLUSH), phenotypically similar to the delta-hemolysin of S. aureus []. Gonococcal growth inhibitor from Staphylococcus acts on the cytoplasmic membrane of the gonococcal cell causing cytoplasmic leakage and, eventually, death [].; GO: 0009405 pathogenesis
Probab=30.60  E-value=1.3e+02  Score=18.43  Aligned_cols=25  Identities=28%  Similarity=0.219  Sum_probs=19.1

Q ss_pred             CHHHHHHHHHHHHHhhCCChHHHHH
Q 045369            1 MVAFFAAVMDTVTTYTGLSPAAFFT   25 (117)
Q Consensus         1 ~~~~~~~~~~~i~~~tglsp~~~~t   25 (117)
                      |..|.++++.++++-..-.-+.+-+
T Consensus         1 M~~l~eAI~n~V~Ag~~~Dwa~lgt   25 (43)
T PF05480_consen    1 MSKLFEAIKNTVQAGQNQDWAKLGT   25 (43)
T ss_pred             CcHHHHHHHHHHHHHHhccHHHHHH
Confidence            7889999999999866555555555


No 51 
>TIGR00822 EII-Sor PTS system, mannose/fructose/sorbose family, IIC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man (PTS splinter group) family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this family can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the sorbose-specific IIC subunits of this family of PTS transporters.
Probab=30.53  E-value=95  Score=25.48  Aligned_cols=25  Identities=24%  Similarity=0.271  Sum_probs=16.6

Q ss_pred             HHHHhhCCChHHHHHHHHHHHHHHH
Q 045369           11 TVTTYTGLSPAAFFTILALMCVVYK   35 (117)
Q Consensus        11 ~i~~~tglsp~~~~tila~~~~vY~   35 (117)
                      .+.+|.|+|-..+..+.+++.++|+
T Consensus       214 ~laayl~l~~l~iAiig~~~A~i~~  238 (265)
T TIGR00822       214 LFAAYTDFSLLAFGAVGGAGALLYI  238 (265)
T ss_pred             HHHHHhCCcHHHHHHHHHHHHHHHH
Confidence            5789999987665555555555554


No 52 
>COG4880 Secreted protein containing C-terminal beta-propeller domain distantly related to WD-40 repeats [General function prediction only]
Probab=30.21  E-value=53  Score=29.78  Aligned_cols=32  Identities=25%  Similarity=0.601  Sum_probs=25.7

Q ss_pred             cccCCCCHHHHhhccCCCCCCCeEEEECCeEEEecC
Q 045369           79 VQLGEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSR  114 (117)
Q Consensus        79 ~~~~~fT~eeL~~ydG~d~~~pi~lAi~G~VYDVt~  114 (117)
                      +|.+-...++.-++||..    ||++++|+||-+..
T Consensus        96 VQVkGvDE~DivKtdG~~----iy~s~~~KvYvi~~  127 (603)
T COG4880          96 VQVKGVDEEDIVKTDGER----IYVSVNGKVYVIDK  127 (603)
T ss_pred             ceEccCCchhhcccCCcE----EEEEeCCeEEEEcC
Confidence            455667788888888855    99999999998754


No 53 
>TIGR01683 thiS thiamine biosynthesis protein ThiS. This model represents ThiS, a small thiamine-biosynthesis protein related to MoaD, a molybdenum cofactor biosynthesis protein. Both proteins are involved in sulfur transfer. ThiS has a conserved Gly-Gly C-terminus that is modified, in reactions requiring ThiI, ThiF, IscS, and a sulfur atom from Cys, into the thiocarboxylate that provides the sulfur for thiazole biosynthesis.
Probab=29.46  E-value=95  Score=19.23  Aligned_cols=27  Identities=26%  Similarity=0.318  Sum_probs=22.4

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEE
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIY  110 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VY  110 (117)
                      ..|..+|.+.-|-+ .+.+-+++||++-
T Consensus        13 ~~tv~~ll~~l~~~-~~~v~v~vN~~iv   39 (64)
T TIGR01683        13 GLTLAALLESLGLD-PRRVAVAVNGEIV   39 (64)
T ss_pred             CCcHHHHHHHcCCC-CCeEEEEECCEEc
Confidence            46889999888877 4689999999984


No 54 
>PRK03625 tatE twin arginine translocase protein E; Validated
Probab=28.84  E-value=59  Score=21.55  Aligned_cols=18  Identities=17%  Similarity=0.453  Sum_probs=12.5

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 ~ig~~elliIlvI~lllF   20 (67)
T PRK03625          3 EISITKLLVVAALVVLLF   20 (67)
T ss_pred             CCcHHHHHHHHHHHHHHc
Confidence            577877777777666554


No 55 
>PF06743 FAST_1:  FAST kinase-like protein, subdomain 1;  InterPro: IPR010622 This entry represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis []. Note that many family members are hypothetical proteins.; GO: 0004672 protein kinase activity
Probab=28.82  E-value=1.6e+02  Score=18.82  Aligned_cols=32  Identities=19%  Similarity=0.636  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHHHh-hCCChHHHHHHHHHHHHH
Q 045369            2 VAFFAAVMDTVTTY-TGLSPAAFFTILALMCVV   33 (117)
Q Consensus         2 ~~~~~~~~~~i~~~-tglsp~~~~tila~~~~v   33 (117)
                      -++|+++.+.+..+ -.++|.....++-.++.+
T Consensus        19 ~~f~~~~~~~L~~~l~~~~p~~ll~~v~Sl~~l   51 (71)
T PF06743_consen   19 EEFFEKLIERLESYLDEFSPEDLLDLVWSLCLL   51 (71)
T ss_pred             HHHHHHHHHHHHHhcccCCHHHHHHHHHHHHHH
Confidence            36899999999999 788898877765554443


No 56 
>PRK06488 sulfur carrier protein ThiS; Validated
Probab=28.68  E-value=81  Score=19.56  Aligned_cols=28  Identities=21%  Similarity=0.116  Sum_probs=22.6

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEEE
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIYD  111 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VYD  111 (117)
                      ..|..+|.++-|-+ .+.+-+|+||+|..
T Consensus        14 ~~tl~~Ll~~l~~~-~~~vavavN~~iv~   41 (65)
T PRK06488         14 ATTLALLLAELDYE-GNWLATAVNGELVH   41 (65)
T ss_pred             cCcHHHHHHHcCCC-CCeEEEEECCEEcC
Confidence            35889999888877 46788999999965


No 57 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=28.67  E-value=61  Score=24.19  Aligned_cols=16  Identities=19%  Similarity=0.416  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHhhc
Q 045369           26 ILALMCVVYKTVCSMF   41 (117)
Q Consensus        26 ila~~~~vY~~v~~~f   41 (117)
                      ++++++++|.++++.|
T Consensus       129 ll~i~~giy~~~r~~~  144 (145)
T PF10661_consen  129 LLAICGGIYVVLRKVW  144 (145)
T ss_pred             HHHHHHHHHHHHHHhh
Confidence            3555667777777765


No 58 
>PRK01614 tatE twin arginine translocase protein A; Validated
Probab=28.46  E-value=63  Score=22.59  Aligned_cols=18  Identities=22%  Similarity=0.510  Sum_probs=11.8

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 GlG~~ELLIIlvIvLLLF   20 (85)
T PRK01614          3 GLSITKLLVVGILIVLLF   20 (85)
T ss_pred             CccHHHHHHHHHHHHHHh
Confidence            677877776666655543


No 59 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=28.30  E-value=58  Score=20.19  Aligned_cols=17  Identities=29%  Similarity=0.698  Sum_probs=9.4

Q ss_pred             CCCeEEEECCeEEEecCCC
Q 045369           98 NKPLLMAIKGQIYDVSRSR  116 (117)
Q Consensus        98 ~~pi~lAi~G~VYDVt~gr  116 (117)
                      ++.-++.  |.+||+...|
T Consensus        41 dg~yli~--G~l~d~~~~~   57 (57)
T PF10411_consen   41 DGRYLIQ--GQLYDLKTKK   57 (57)
T ss_dssp             TSSEEEE--S-EEE-TTTS
T ss_pred             CCCEEEE--eEEEecCCCC
Confidence            3344443  9999998764


No 60 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=28.01  E-value=45  Score=25.98  Aligned_cols=24  Identities=4%  Similarity=0.144  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccCC
Q 045369           21 AAFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        21 ~~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      +.||-.++..+++|+++++++-+|
T Consensus        54 ~~l~w~~I~FliL~~lL~k~~~~p   77 (204)
T PRK09174         54 SQLLWLAITFGLFYLFMSRVILPR   77 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            366666677777777777776543


No 61 
>PTZ00046 rifin; Provisional
Probab=27.62  E-value=94  Score=26.83  Aligned_cols=21  Identities=24%  Similarity=0.392  Sum_probs=16.1

Q ss_pred             CChHHHHHHHHHHHHHHHHHH
Q 045369           18 LSPAAFFTILALMCVVYKTVC   38 (117)
Q Consensus        18 lsp~~~~tila~~~~vY~~v~   38 (117)
                      .|-.+++.|+++++.+|++++
T Consensus       319 aSiiAIvVIVLIMvIIYLILR  339 (358)
T PTZ00046        319 ASIVAIVVIVLIMVIIYLILR  339 (358)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            355677777888888898887


No 62 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=27.62  E-value=71  Score=27.51  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=16.0

Q ss_pred             CChHHHHHHHHHHHHHHHHHH
Q 045369           18 LSPAAFFTILALMCVVYKTVC   38 (117)
Q Consensus        18 lsp~~~~tila~~~~vY~~v~   38 (117)
                      .|-.+++.|+++++.+|++++
T Consensus       314 aSiIAIvvIVLIMvIIYLILR  334 (353)
T TIGR01477       314 ASIIAILIIVLIMVIIYLILR  334 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            345677777888888898887


No 63 
>TIGR01411 tatAE twin arginine-targeting protein translocase, TatA/E family. This model distinguishes TatA/E from the related TatB, but does not distinguish TatA from TatE. The Tat (twin-arginine translocation) system is a Sec-independent exporter for folded proteins, often with a redox cofactor already bound, across the bacterial inner membrane. Functionally equivalent systems are found in the chloroplast and some in archaeal species. The signal peptide recognized by the Tat system is modeled by TIGR01409.
Probab=27.52  E-value=70  Score=19.53  Aligned_cols=17  Identities=35%  Similarity=0.788  Sum_probs=10.4

Q ss_pred             CCChHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVV   33 (117)
Q Consensus        17 glsp~~~~tila~~~~v   33 (117)
                      |++++-++.++++++++
T Consensus         1 gig~~ElliI~vi~llv   17 (47)
T TIGR01411         1 GLSPPEWLIILVVILLL   17 (47)
T ss_pred             CCCHHHHHHHHHHHHHh
Confidence            56677666666655553


No 64 
>PRK08053 sulfur carrier protein ThiS; Provisional
Probab=26.87  E-value=1.2e+02  Score=18.96  Aligned_cols=27  Identities=30%  Similarity=0.146  Sum_probs=21.7

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEE
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIY  110 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VY  110 (117)
                      ..|..+|.+.-|.+ .+.|-+|+||+|.
T Consensus        15 ~~tl~~ll~~l~~~-~~~vaVavN~~iv   41 (66)
T PRK08053         15 GQTVHELLEQLNQL-QPGAALAINQQII   41 (66)
T ss_pred             CCCHHHHHHHcCCC-CCcEEEEECCEEe
Confidence            47888888877766 4579999999994


No 65 
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.77  E-value=1.1e+02  Score=22.44  Aligned_cols=16  Identities=25%  Similarity=0.575  Sum_probs=12.2

Q ss_pred             HHHhhCCChHHHHHHH
Q 045369           12 VTTYTGLSPAAFFTIL   27 (117)
Q Consensus        12 i~~~tglsp~~~~til   27 (117)
                      +.+|.|.|||-++..+
T Consensus        66 lD~~agTsPwglIv~l   81 (116)
T COG5336          66 LDKFAGTSPWGLIVFL   81 (116)
T ss_pred             HHHhcCCCcHHHHHHH
Confidence            4688999999876643


No 66 
>PF06570 DUF1129:  Protein of unknown function (DUF1129);  InterPro: IPR009214 There are currently no experimental data for members of this group or their homologues. However, these proteins contain predicted integral membrane proteins (with several transmembrane segments).
Probab=26.39  E-value=92  Score=23.78  Aligned_cols=26  Identities=12%  Similarity=0.094  Sum_probs=21.6

Q ss_pred             CCChHHHHHHHHHHHHHHHHHHhhcc
Q 045369           17 GLSPAAFFTILALMCVVYKTVCSMFV   42 (117)
Q Consensus        17 glsp~~~~tila~~~~vY~~v~~~f~   42 (117)
                      -|||+..+.+.++++++++.+++.|.
T Consensus       177 ~l~~~~~iiig~i~~~~~~~lkkk~~  202 (206)
T PF06570_consen  177 VLPPWVYIIIGVIAFALRFYLKKKYN  202 (206)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHhC
Confidence            47788888888999999999888763


No 67 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=25.42  E-value=76  Score=23.09  Aligned_cols=24  Identities=4%  Similarity=0.184  Sum_probs=11.6

Q ss_pred             CChHHHHHHHHHHHHHHHHHHhhc
Q 045369           18 LSPAAFFTILALMCVVYKTVCSMF   41 (117)
Q Consensus        18 lsp~~~~tila~~~~vY~~v~~~f   41 (117)
                      +++.+|+..++..++++.++..++
T Consensus         3 ~~~~~~~~~~inF~il~~iL~~f~   26 (159)
T PRK13461          3 INIPTIIATIINFIILLLILKHFF   26 (159)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHh
Confidence            455555554444444444444443


No 68 
>PHA02902 putative IMV membrane protein; Provisional
Probab=24.83  E-value=2.2e+02  Score=19.12  Aligned_cols=17  Identities=12%  Similarity=0.263  Sum_probs=12.3

Q ss_pred             CCCcccCCCCHHHHhhc
Q 045369           76 PETVQLGEVTEHELRAY   92 (117)
Q Consensus        76 ~~p~~~~~fT~eeL~~y   92 (117)
                      ..+.-...+|++|.+.+
T Consensus        46 ~d~~F~D~lTpDQirAl   62 (70)
T PHA02902         46 DDPLFKDSLTPDQIKAL   62 (70)
T ss_pred             CCchhhccCCHHHHHHH
Confidence            44555678999998765


No 69 
>COG2028 Uncharacterized conserved protein [Function unknown]
Probab=24.73  E-value=57  Score=24.63  Aligned_cols=24  Identities=33%  Similarity=0.357  Sum_probs=16.2

Q ss_pred             CCCHHHHhhccC------C-CCCCCeEEEEC
Q 045369           83 EVTEHELRAYDG------S-DPNKPLLMAIK  106 (117)
Q Consensus        83 ~fT~eeL~~ydG------~-d~~~pi~lAi~  106 (117)
                      -+|+|||++|+-      . ...+.-||+|.
T Consensus        79 FLT~eElkkY~ks~~rWg~r~kkkkpWmvi~  109 (145)
T COG2028          79 FLTPEELKKYMKSRKRWGSRGKKKKPWMVIE  109 (145)
T ss_pred             ecCHHHHHHHHHHHHHhccccccCCceEEEE
Confidence            489999999983      2 12345677763


No 70 
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B. Alp11, also known as tubulin-folding cofactor B, is one of at least three proteins required for the proper folding of tubulins prior to their incorporation into microtubules.  These cofactors are necessary for the biogenesis of microtubules and for cell viability.  Alp11 has three domains including an N-terminal ubiquitin-like domain (represented by this CD) which executes the essential function, a central coiled-coil domain necessary for maintenance of cellular alpha-tubulin levels, and a C-terminal CLIP-170 domain is required for efficient binding to alpha-tubulin.
Probab=24.61  E-value=51  Score=21.82  Aligned_cols=19  Identities=11%  Similarity=0.239  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHhhCCChHHH
Q 045369            5 FAAVMDTVTTYTGLSPAAF   23 (117)
Q Consensus         5 ~~~~~~~i~~~tglsp~~~   23 (117)
                      |+.||+-|...||.+|..+
T Consensus        25 v~~lK~kl~~~~G~~~~~m   43 (84)
T cd01789          25 IAELKKKLELVVGTPASSM   43 (84)
T ss_pred             HHHHHHHHHHHHCCCccce
Confidence            5789999999999988654


No 71 
>PRK05659 sulfur carrier protein ThiS; Validated
Probab=24.33  E-value=1.4e+02  Score=18.34  Aligned_cols=28  Identities=18%  Similarity=0.290  Sum_probs=23.0

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEEE
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIYD  111 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VYD  111 (117)
                      ..|..+|.+.-|-+ ...+-++++|.|+.
T Consensus        15 ~~tl~~lL~~l~~~-~~~vav~vNg~iv~   42 (66)
T PRK05659         15 GESVAALLAREGLA-GRRVAVEVNGEIVP   42 (66)
T ss_pred             CCCHHHHHHhcCCC-CCeEEEEECCeEeC
Confidence            37889999888877 56788999998875


No 72 
>PRK07696 sulfur carrier protein ThiS; Provisional
Probab=24.13  E-value=1.2e+02  Score=19.32  Aligned_cols=26  Identities=27%  Similarity=0.149  Sum_probs=21.9

Q ss_pred             CCHHHHhhccCCCCCCCeEEEECCeEE
Q 045369           84 VTEHELRAYDGSDPNKPLLMAIKGQIY  110 (117)
Q Consensus        84 fT~eeL~~ydG~d~~~pi~lAi~G~VY  110 (117)
                      .|..+|-+.-|-+ .+.+-+++||.|.
T Consensus        17 ~tv~~lL~~l~~~-~~~vav~vN~~iv   42 (67)
T PRK07696         17 KTVAELLTHLELD-NKIVVVERNKDIL   42 (67)
T ss_pred             ccHHHHHHHcCCC-CCeEEEEECCEEe
Confidence            5788998888887 5689999999985


No 73 
>PRK14859 tatA twin arginine translocase protein A; Provisional
Probab=23.92  E-value=90  Score=20.41  Aligned_cols=18  Identities=22%  Similarity=0.617  Sum_probs=11.5

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 giG~~ElliIlvv~Llvf   20 (63)
T PRK14859          3 GIGMPELIVILVIVLIVF   20 (63)
T ss_pred             CccHHHHHHHHHHHHHHh
Confidence            566776666666666554


No 74 
>PHA00736 hypothetical protein
Probab=23.62  E-value=1.3e+02  Score=20.49  Aligned_cols=29  Identities=38%  Similarity=0.607  Sum_probs=21.1

Q ss_pred             HHHhhCCChH-HHHHHHHHHHHHHHHHHhh
Q 045369           12 VTTYTGLSPA-AFFTILALMCVVYKTVCSM   40 (117)
Q Consensus        12 i~~~tglsp~-~~~tila~~~~vY~~v~~~   40 (117)
                      +.--|||-|. +++.+++.+-+.|++.-++
T Consensus         7 lal~tglgpvi~viiil~mmgltykmagki   36 (79)
T PHA00736          7 LALQTGLGPVIAIIIILAMMGLTYKMAGKI   36 (79)
T ss_pred             HHHHcCCccHHHHHHHHHHHhhHHHHhCCc
Confidence            3446899996 5666777888888886644


No 75 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=23.36  E-value=82  Score=23.40  Aligned_cols=26  Identities=12%  Similarity=0.141  Sum_probs=12.8

Q ss_pred             hCCChHHHHHHHHHHHHHHHHHHhhc
Q 045369           16 TGLSPAAFFTILALMCVVYKTVCSMF   41 (117)
Q Consensus        16 tglsp~~~~tila~~~~vY~~v~~~f   41 (117)
                      .+.+|..||-.++..+++|.++..++
T Consensus        14 ~~~~~~~~~~~~i~Flil~~lL~~~l   39 (175)
T PRK14472         14 LSPNPGLIFWTAVTFVIVLLILKKIA   39 (175)
T ss_pred             cCCCHHHHHHHHHHHHHHHHHHHHHh
Confidence            34566566554444444444444443


No 76 
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=23.21  E-value=71  Score=24.15  Aligned_cols=23  Identities=13%  Similarity=0.306  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHHhhccCC
Q 045369           22 AFFTILALMCVVYKTVCSMFVDP   44 (117)
Q Consensus        22 ~~~tila~~~~vY~~v~~~f~~~   44 (117)
                      .+|-.++..+++|+++++++-+|
T Consensus        33 q~~~~lI~F~iL~~ll~k~l~~P   55 (181)
T PRK13454         33 QIFWLLVTLVAIYFVLTRVALPR   55 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            44444555666666666665443


No 77 
>PRK00191 tatA twin arginine translocase protein A; Provisional
Probab=23.08  E-value=92  Score=21.65  Aligned_cols=18  Identities=28%  Similarity=0.451  Sum_probs=12.0

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         2 ~ig~~ElliI~vI~lllF   19 (84)
T PRK00191          2 SLGPWEIGIIVLLIIVLF   19 (84)
T ss_pred             CCcHHHHHHHHHHHHHHh
Confidence            677777777666665554


No 78 
>PRK07440 hypothetical protein; Provisional
Probab=22.96  E-value=1.6e+02  Score=18.99  Aligned_cols=28  Identities=14%  Similarity=0.191  Sum_probs=23.0

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEEE
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIYD  111 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VYD  111 (117)
                      ..|..+|-+.-|-+ .+.|-+++||.|..
T Consensus        19 ~~tl~~lL~~l~~~-~~~vav~~N~~iv~   46 (70)
T PRK07440         19 GTSLPDLLQQLGFN-PRLVAVEYNGEILH   46 (70)
T ss_pred             CCCHHHHHHHcCCC-CCeEEEEECCEEeC
Confidence            47888988877777 56899999999965


No 79 
>TIGR03758 conj_TIGR03758 integrating conjugative element protein, PFL_4701 family. Members of this family of small, hydrophobic proteins are found occasionally on plasmids such as the Pseudomonas putida TOL (toluene catabolic) plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition.
Probab=22.62  E-value=2.1e+02  Score=18.90  Aligned_cols=26  Identities=15%  Similarity=0.300  Sum_probs=17.9

Q ss_pred             HHHHHhhCCChHHHHHHHHHHHHHHH
Q 045369           10 DTVTTYTGLSPAAFFTILALMCVVYK   35 (117)
Q Consensus        10 ~~i~~~tglsp~~~~tila~~~~vY~   35 (117)
                      .+-++-.|++|..+-++++.+++...
T Consensus         6 sAFqA~SG~~p~~l~~l~lG~~~~vl   31 (65)
T TIGR03758         6 SAFQAASGIDPQAMNTLILGLVLAVL   31 (65)
T ss_pred             HHHHhccCCCHHHHHHHHHHHHHHHH
Confidence            45677799999988886555444433


No 80 
>PF05279 Asp-B-Hydro_N:  Aspartyl beta-hydroxylase N-terminal region;  InterPro: IPR007943 This domain is found in members of the junctin, junctate and aspartyl beta-hydroxylase protein families. Junctate is an integral ER/SR membrane calcium binding protein, which comes from an alternatively spliced form of the same gene that generates aspartyl beta-hydroxylase and junctin []. Aspartyl beta-hydroxylase catalyses the post-translational hydroxylation of aspartic acid or asparagine residues contained within epidermal growth factor (EGF) domains of proteins []. This domain is also found in several eukaryotic triadin proteins. Triadin is a ryanodine receptor and calsequestrin binding protein located in junctional sarcoplasmic reticulum of striated muscles [].; GO: 0016020 membrane
Probab=22.44  E-value=1e+02  Score=25.09  Aligned_cols=16  Identities=44%  Similarity=0.588  Sum_probs=11.0

Q ss_pred             CCChHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCV   32 (117)
Q Consensus        17 glsp~~~~tila~~~~   32 (117)
                      |-||++.|+++|++.+
T Consensus         9 G~~~~~~~~~~~~~~~   24 (243)
T PF05279_consen    9 GSSFFTWFLVLALLGV   24 (243)
T ss_pred             CCchHHHHHHHHHHHH
Confidence            5678777777776543


No 81 
>smart00309 PAH Pancreatic hormones / neuropeptide F / peptide YY family. Pancreatic hormone is a regulator of pancreatic and gastrointestinal functions.
Probab=22.40  E-value=77  Score=18.74  Aligned_cols=12  Identities=25%  Similarity=0.537  Sum_probs=9.9

Q ss_pred             CCCCHHHHhhcc
Q 045369           82 GEVTEHELRAYD   93 (117)
Q Consensus        82 ~~fT~eeL~~yd   93 (117)
                      .+.|+|||++|=
T Consensus        10 ~~a~~e~l~~Y~   21 (36)
T smart00309       10 DDASPEDLRQYL   21 (36)
T ss_pred             CCCCHHHHHHHH
Confidence            578999999984


No 82 
>PRK06083 sulfur carrier protein ThiS; Provisional
Probab=22.10  E-value=1.5e+02  Score=20.03  Aligned_cols=28  Identities=14%  Similarity=0.052  Sum_probs=22.7

Q ss_pred             CCCHHHHhhccCCCCCCCeEEEECCeEEE
Q 045369           83 EVTEHELRAYDGSDPNKPLLMAIKGQIYD  111 (117)
Q Consensus        83 ~fT~eeL~~ydG~d~~~pi~lAi~G~VYD  111 (117)
                      ..|..+|-..-+-+ .+.|-+++||.|..
T Consensus        33 ~~tl~~LL~~l~~~-~~~vAVevNg~iVp   60 (84)
T PRK06083         33 SSSLAQIIAQLSLP-ELGCVFAINNQVVP   60 (84)
T ss_pred             CCcHHHHHHHcCCC-CceEEEEECCEEeC
Confidence            47888888877776 67899999999863


No 83 
>PRK00442 tatA twin arginine translocase protein A; Provisional
Probab=21.39  E-value=99  Score=21.80  Aligned_cols=18  Identities=17%  Similarity=0.338  Sum_probs=11.7

Q ss_pred             CCChHHHHHHHHHHHHHH
Q 045369           17 GLSPAAFFTILALMCVVY   34 (117)
Q Consensus        17 glsp~~~~tila~~~~vY   34 (117)
                      |++++-++.|++++++++
T Consensus         3 ~~g~~elliIlvIvlllF   20 (92)
T PRK00442          3 IFDWKHWIVILVVVVLVF   20 (92)
T ss_pred             CccHHHHHHHHHHHHHHh
Confidence            467777777666666554


No 84 
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism]
Probab=21.38  E-value=1.3e+02  Score=19.73  Aligned_cols=27  Identities=26%  Similarity=0.315  Sum_probs=23.6

Q ss_pred             CCHHHHhhccCCCCCCCeEEEECCeEEE
Q 045369           84 VTEHELRAYDGSDPNKPLLMAIKGQIYD  111 (117)
Q Consensus        84 fT~eeL~~ydG~d~~~pi~lAi~G~VYD  111 (117)
                      .|.++|-+--|-+ ...+-+++||.|..
T Consensus        18 ~tv~dLL~~l~~~-~~~vav~vNg~iVp   44 (68)
T COG2104          18 TTVADLLAQLGLN-PEGVAVAVNGEIVP   44 (68)
T ss_pred             CcHHHHHHHhCCC-CceEEEEECCEEcc
Confidence            7889999999988 67899999999864


No 85 
>PF05132 RNA_pol_Rpc4:  RNA polymerase III RPC4;  InterPro: IPR007811 This family comprises a specific subunit for Pol III, the tRNA specific polymerase.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006383 transcription from RNA polymerase III promoter, 0005666 DNA-directed RNA polymerase III complex
Probab=21.33  E-value=1.1e+02  Score=21.87  Aligned_cols=19  Identities=26%  Similarity=0.490  Sum_probs=16.4

Q ss_pred             CCCeEEEECCeEEEecCCC
Q 045369           98 NKPLLMAIKGQIYDVSRSR  116 (117)
Q Consensus        98 ~~pi~lAi~G~VYDVt~gr  116 (117)
                      ++++=|-+.|.+|||+.|-
T Consensus        77 SGkv~l~iG~~~~dV~~G~   95 (131)
T PF05132_consen   77 SGKVTLKIGGVVFDVSPGT   95 (131)
T ss_pred             CCcEEEEECCEEEEecCCC
Confidence            5678899999999999884


No 86 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=20.66  E-value=2.5e+02  Score=18.21  Aligned_cols=29  Identities=10%  Similarity=0.116  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHhhCCChHHHHHHHHHHHHHHHHHH
Q 045369            5 FAAVMDTVTTYTGLSPAAFFTILALMCVVYKTVC   38 (117)
Q Consensus         5 ~~~~~~~i~~~tglsp~~~~tila~~~~vY~~v~   38 (117)
                      |+++++.+.+     -.+++..++.++++|+..+
T Consensus         3 ~e~~~~~a~a-----~~t~~~~l~fiavi~~ayr   31 (60)
T COG4736           3 YEMMRGFADA-----WGTIAFTLFFIAVIYFAYR   31 (60)
T ss_pred             HHHHHHHHHH-----HHHHHHHHHHHHHHHHHhc
Confidence            5666665544     3344444444555555543


No 87 
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=20.65  E-value=59  Score=29.20  Aligned_cols=16  Identities=19%  Similarity=0.646  Sum_probs=12.7

Q ss_pred             CCeEEEECCeEEEecC
Q 045369           99 KPLLMAIKGQIYDVSR  114 (117)
Q Consensus        99 ~pi~lAi~G~VYDVt~  114 (117)
                      ...|....|+|||+|.
T Consensus       377 ~tyy~c~DgkVYDITe  392 (490)
T KOG0720|consen  377 PTYYACMDGKVYDITE  392 (490)
T ss_pred             ceeeeecCCceEeehh
Confidence            3577788899999984


No 88 
>PF11100 TrbE:  Conjugal transfer protein TrbE ;  InterPro: IPR020150 TrbE is encoded by the F-plasmid and is located between traN and traF. The product of trbE is a small, integral, inner membrane protein. Mutation of trbE by insertional mutagenesis suggests that TrbE is not essential for F transfer from Escherichia coli (strain K12) under standard mating conditions [].
Probab=20.21  E-value=54  Score=21.92  Aligned_cols=36  Identities=11%  Similarity=0.102  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHhhCCChHHHHHHHHHHHHHHHHHHhh
Q 045369            5 FAAVMDTVTTYTGLSPAAFFTILALMCVVYKTVCSM   40 (117)
Q Consensus         5 ~~~~~~~i~~~tglsp~~~~tila~~~~vY~~v~~~   40 (117)
                      |+|+|++=..-.-++-.-++.....+...|..++.+
T Consensus        24 WDaVk~Tt~~d~l~a~~~I~~~g~~~~~~y~ffs~L   59 (66)
T PF11100_consen   24 WDAVKETTASDILEAVFFILASGFMLFILYCFFSAL   59 (66)
T ss_pred             eccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            667766422211111222222334455556555544


No 89 
>PF04033 DUF365:  Domain of unknown function (DUF365);  InterPro: IPR007176 This is an archaeal family of unknown function.; PDB: 2KKU_A.
Probab=20.04  E-value=76  Score=22.65  Aligned_cols=24  Identities=42%  Similarity=0.583  Sum_probs=13.5

Q ss_pred             CCCHHHHhhcc------CC-CCCCCeEEEEC
Q 045369           83 EVTEHELRAYD------GS-DPNKPLLMAIK  106 (117)
Q Consensus        83 ~fT~eeL~~yd------G~-d~~~pi~lAi~  106 (117)
                      -+|+|||++|.      |. ...+.-||+|.
T Consensus        41 FLT~eE~r~Y~~~~~Rwg~~~~r~rpwmvi~   71 (97)
T PF04033_consen   41 FLTKEELRKYERSRKRWGSGGKRKRPWMVIE   71 (97)
T ss_dssp             SS-HHHHHHHHHHHHHTSS--SS---EEEEE
T ss_pred             ecCHHHHHHHHhhHHhhccCCCCCCceEEEE
Confidence            48999999997      22 22445778774


Done!