BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045419
         (70 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CC1|L Chain L, Crystal Structure Of A Reduced, Active Form Of The
           Ni-Fe-Se Hydrogenase From Desulfomicrobium Baculatum
          Length = 498

 Score = 25.8 bits (55), Expect = 6.6,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 27  LEPFVNHASQMAALDYIVSIESDVFIPSYS 56
           L+  + H   +AALDY+   +   F+P Y+
Sbjct: 110 LQSHILHFYHLAALDYVKGPDVSPFVPRYA 139


>pdb|2HK2|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Monoclinic Form)
 pdb|2HK2|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Monoclinic Form)
 pdb|2HK3|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Orthorhombic Form)
 pdb|2HK3|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Orthorhombic Form)
          Length = 331

 Score = 25.8 bits (55), Expect = 6.9,   Method: Composition-based stats.
 Identities = 9/31 (29%), Positives = 19/31 (61%)

Query: 24  VEELEPFVNHASQMAALDYIVSIESDVFIPS 54
           +E++  +++     A +D+   IESD F+P+
Sbjct: 74  LEKISKYMDIVRNRAGIDWYAEIESDNFVPT 104


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.129    0.345 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,627,369
Number of Sequences: 62578
Number of extensions: 43461
Number of successful extensions: 127
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 125
Number of HSP's gapped (non-prelim): 3
length of query: 70
length of database: 14,973,337
effective HSP length: 40
effective length of query: 30
effective length of database: 12,470,217
effective search space: 374106510
effective search space used: 374106510
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)