BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045419
         (70 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q8W486|Y1491_ARATH Uncharacterized protein At1g04910 OS=Arabidopsis thaliana
           GN=At1g04910 PE=1 SV=1
          Length = 519

 Score = 29.6 bits (65), Expect = 5.5,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 15/44 (34%)

Query: 14  SATKQGKLASVEELEPFVNHASQMAALDYIVSIESDVFIPSYSG 57
           SAT QG + S               A+DY+V + SD+F+P+Y G
Sbjct: 368 SATSQGLIGS---------------AVDYMVCLLSDIFMPTYDG 396


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.318    0.129    0.345 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,705,087
Number of Sequences: 539616
Number of extensions: 554198
Number of successful extensions: 1796
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1794
Number of HSP's gapped (non-prelim): 3
length of query: 70
length of database: 191,569,459
effective HSP length: 42
effective length of query: 28
effective length of database: 168,905,587
effective search space: 4729356436
effective search space used: 4729356436
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)