Citrus Sinensis ID: 045421

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEASGLSEDLRFKTLRDHPREMNSSGLEGSLSRYSSFLSGSSPTDDVREINAEAYLKFKAMRDSHIHMERQSSVAQVSTPVPSWTGSSKSAHDVQNHPLASFKFQHSTFL
cccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEccccccccccccccccHHHHccccccEEccccccccccccccccccccccccccccccccc
cccHHHHccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHccccccccEEEEEcccccccccccccccccccccHHEEEcccccc
sgtlmelvdprlgsefnKVEAERMIKIALLCtnaspslrptMSEVVSMLegssnipdvipeasglsedLRFKTlrdhpremnssglegslsryssflsgssptddvREINAEAYLKFKAMrdshihmerqssvaqvstpvpswtgssksahdvqnhplasfkfqhstfl
sgtlmelvdprlgsefnKVEAERMIKIALlctnaspslrPTMSEVVSMLEGSSNIPDVIPEASGLSEDLRFKTLRDhpremnssglegslSRYSSFlsgssptddvREINAEAYLKFKAMRDSHIHMERQSSVAQVSTPVPSWTGSSKSAHDVQNHPlasfkfqhstfl
SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEASGLSEDLRFKTLRDHPREMNSSGLEgslsryssflsgssPTDDVREINAEAYLKFKAMRDSHIHMERQSSVAQVSTPVPSWTGSSKSAHDVQNHPLASFKFQHSTFL
*****************KVEAERMIKIALLCTN********************************************************************************YLK*****************************************************
SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPE***************************************************************************STPVPSWTGSSKSAHDVQNHPLASFKFQHSTFL
SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEASGLSEDLRFKTLRDHPREMNSSGLEGSLSRYSSFLSGSSPTDDVREINAEAYLKFKAMRDSHIHM************************DVQNHPLASFKFQHSTFL
***LMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEASGLSEDLRFKTLRD******************************************************SSV*Q*STPVPS*****KSAHDVQNHPLASFKFQHS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEASGLSEDLRFKTLRDHPREMNSSGLEGSLSRYSSFLSGSSPTDDVREINAEAYLKFKAMRDSHIHMERQSSVAQVSTPVPSWTGSSKSAHDVQNHPLASFKFQHSTFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
Q9FXF21021 Probable LRR receptor-lik yes no 0.497 0.082 0.488 1e-15
Q9ASQ61019 Probable LRR receptor-lik no no 0.585 0.097 0.441 2e-15
C0LGE01014 Probable LRR receptor-lik no no 0.449 0.074 0.473 7e-15
C0LGG81038 Probable LRR receptor-lik no no 0.514 0.083 0.536 1e-14
C0LGG91035 Probable LRR receptor-lik no no 0.426 0.069 0.597 2e-14
C0LGG7953 Probable LRR receptor-lik no no 0.520 0.092 0.460 2e-12
C0LGN21020 Probable leucine-rich rep no no 0.313 0.051 0.603 2e-12
O65238872 G-type lectin S-receptor- no no 0.420 0.081 0.486 3e-10
C0LGH21032 Probable LRR receptor-lik no no 0.384 0.062 0.522 7e-10
Q9M1G3669 Probable L-type lectin-do no no 0.378 0.095 0.406 2e-09
>sp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/84 (48%), Positives = 59/84 (70%)

Query: 1   SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIP 60
           SG LM++VD RL  E ++ EAE +IK+AL+C++ASP+ RP MSEVV+MLEG   +P+  P
Sbjct: 904 SGHLMQVVDERLRPEVDRKEAEAVIKVALVCSSASPTDRPLMSEVVAMLEGLYPVPESTP 963

Query: 61  EASGLSEDLRFKTLRDHPREMNSS 84
             S  + D+RFK  +D  R M ++
Sbjct: 964 GVSRNAGDIRFKAFKDLRRGMENN 987

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 Back     alignment and function description
>sp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2 Back     alignment and function description
>sp|C0LGG7|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2 Back     alignment and function description
>sp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=1 SV=1 Back     alignment and function description
>sp|O65238|Y5537_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 OS=Arabidopsis thaliana GN=At5g35370 PE=2 SV=2 Back     alignment and function description
>sp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2 Back     alignment and function description
>sp|Q9M1G3|LRK16_ARATH Probable L-type lectin-domain containing receptor kinase I.6 OS=Arabidopsis thaliana GN=LECRK16 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
297740557 839 unnamed protein product [Vitis vinifera] 1.0 0.201 0.458 6e-33
255562540 2046 kinase, putative [Ricinus communis] gi|2 0.786 0.065 0.557 1e-32
147838007 667 hypothetical protein VITISV_025000 [Viti 0.946 0.239 0.470 2e-31
359483540 1066 PREDICTED: probable LRR receptor-like se 0.946 0.150 0.464 2e-31
224116760 1024 predicted protein [Populus trichocarpa] 0.840 0.138 0.490 2e-26
224079009 1030 predicted protein [Populus trichocarpa] 0.834 0.136 0.512 6e-26
297740570 511 unnamed protein product [Vitis vinifera] 0.603 0.199 0.575 9e-24
351725611176 receptor-like kinase [Glycine max] gi|22 0.538 0.517 0.582 4e-23
297740568 522 unnamed protein product [Vitis vinifera] 0.443 0.143 0.693 6e-23
359483554 933 PREDICTED: probable LRR receptor-like se 0.443 0.080 0.693 7e-23
>gi|297740557|emb|CBI30739.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 83/181 (45%), Positives = 113/181 (62%), Gaps = 12/181 (6%)

Query: 1   SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIP 60
           SG +MELVD +LGSEFNK EAERMIK+ALLCTNASPSLRP MSE VSMLEG + IPD IP
Sbjct: 607 SGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDAIP 666

Query: 61  EASGLSEDLRFKTLRDHPREMNSSGLE-------GSLSRYSSFLSGSSPTDDVREINAEA 113
           EA   SEDLRFK +R++ +   S  LE        +  R +   S S+   D+ +IN E+
Sbjct: 667 EAGSYSEDLRFKAIREYHKHTRSKVLEISEVQADSTSGRQAWIQSTSASAHDLYDINMES 726

Query: 114 YLKFKAMRDSHIHME---RQSSVAQVSTPVPSWTGSSKSAHDVQNHPLAS--FKFQHSTF 168
           YL+ ++ R  +  +E    + +  ++++  P  + SS S  D+ +  L S  F F ++ F
Sbjct: 727 YLRSRSTRQHNTEIESHLSEGTQTEITSKHPWISSSSTSGQDLYSFNLESHYFDFHNNGF 786

Query: 169 L 169
           L
Sbjct: 787 L 787

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255562540|ref|XP_002522276.1| kinase, putative [Ricinus communis] gi|223538529|gb|EEF40134.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147838007|emb|CAN73789.1| hypothetical protein VITISV_025000 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483540|ref|XP_002264878.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase RFK1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116760|ref|XP_002317385.1| predicted protein [Populus trichocarpa] gi|222860450|gb|EEE97997.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224079009|ref|XP_002305716.1| predicted protein [Populus trichocarpa] gi|222848680|gb|EEE86227.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297740570|emb|CBI30752.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351725611|ref|NP_001238634.1| receptor-like kinase [Glycine max] gi|223452345|gb|ACM89500.1| receptor-like kinase [Glycine max] Back     alignment and taxonomy information
>gi|297740568|emb|CBI30750.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483554|ref|XP_002264139.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g29720-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:20193671078 AT1G29740 [Arabidopsis thalian 0.420 0.065 0.521 1.9e-14
TAIR|locus:22038471021 RKF1 "receptor-like kinase in 0.497 0.082 0.488 3.6e-14
TAIR|locus:22037181035 AT1G53440 [Arabidopsis thalian 0.437 0.071 0.575 7.7e-14
TAIR|locus:2019317969 AT1G29730 [Arabidopsis thalian 0.420 0.073 0.507 4e-13
TAIR|locus:2009630953 AT1G53420 [Arabidopsis thalian 0.497 0.088 0.458 3.5e-12
TAIR|locus:2182603872 AT5G35370 [Arabidopsis thalian 0.420 0.081 0.486 2.4e-09
TAIR|locus:2085587669 AT3G45440 [Arabidopsis thalian 0.372 0.094 0.412 2.7e-09
TAIR|locus:22052501032 AT1G56130 [Arabidopsis thalian 0.384 0.062 0.522 4.9e-09
TAIR|locus:2133229674 LPK1 "lectin-like protein kina 0.349 0.087 0.389 5.8e-09
TAIR|locus:2118811648 SARK "SENESCENCE-ASSOCIATED RE 0.272 0.070 0.543 6.8e-09
TAIR|locus:2019367 AT1G29740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 198 (74.8 bits), Expect = 1.9e-14, P = 1.9e-14
 Identities = 37/71 (52%), Positives = 53/71 (74%)

Query:     2 GTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPE 61
             G   E++DP+L   F+ +EAERMIK++LLC++ SP+LRPTMSEVV MLEG + I ++I +
Sbjct:   900 GAFDEILDPKLEGVFDVMEAERMIKVSLLCSSKSPTLRPTMSEVVKMLEGETEIEEIISD 959

Query:    62 ASGLSEDLRFK 72
                  ++LRFK
Sbjct:   960 PGAYGDELRFK 970
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2203847 RKF1 "receptor-like kinase in flowers 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203718 AT1G53440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019317 AT1G29730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009630 AT1G53420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182603 AT5G35370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085587 AT3G45440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205250 AT1G56130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133229 LPK1 "lectin-like protein kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118811 SARK "SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
KOG1187361 consensus Serine/threonine protein kinase [Signal 98.48
PLN00113968 leucine-rich repeat receptor-like protein kinase; 96.39
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 91.14
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 88.82
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 87.78
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 87.15
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 87.02
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 86.23
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 85.2
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 84.67
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 84.18
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 83.79
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 82.4
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 82.08
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 82.04
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 81.74
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 80.07
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=98.48  E-value=1.8e-07  Score=82.03  Aligned_cols=53  Identities=45%  Similarity=0.747  Sum_probs=46.4

Q ss_pred             CCcccccCCccC-CCCcH-HHHHHHHHHHHhhcCCCCCCCCCHhHHHHHhhcCCC
Q 045421            2 GTLMELVDPRLG-SEFNK-VEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSN   54 (169)
Q Consensus         2 g~l~eiVDprL~-~~~~~-eel~r~l~VALlC~~~~p~~RPtM~~VV~~L~g~~~   54 (169)
                      +++.+|+||+|. +.+.. +++.+++.+|++|++.+|..||.|.+|+++|+....
T Consensus       300 ~~~~eiiD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv~~L~~~~~  354 (361)
T KOG1187|consen  300 GKLREIVDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVVKELEGILS  354 (361)
T ss_pred             cchhheeCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHHHHHHhhcc
Confidence            468899999996 66664 799999999999999999999999999999965443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 8e-08
3uim_A326 Structural Basis For The Impact Of Phosphorylation 9e-08
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure 
Iteration: 1

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (65%)
Query: 7   LVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSS 53
           LVD  L   +   E E++I++ALLCT +SP  RP MSEVV MLEG  
Sbjct: 272 LVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDG 318
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 6e-24
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 3e-18
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-17
3soc_A322 Activin receptor type-2A; structural genomics cons 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
 Score = 94.2 bits (235), Expect = 6e-24
 Identities = 26/51 (50%), Positives = 32/51 (62%)

Query: 1   SGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEG 51
              L  LVD  L   +   E E++I++ALLCT +SP  RP MSEVV MLEG
Sbjct: 258 EKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEG 308
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 96.96
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 96.54
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 95.3
4aoj_A329 High affinity nerve growth factor receptor; transf 93.96
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 93.34
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 92.84
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 91.82
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 91.36
3soc_A322 Activin receptor type-2A; structural genomics cons 91.33
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 90.72
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 90.58
3poz_A327 Epidermal growth factor receptor; kinase domain, a 89.96
4ase_A353 Vascular endothelial growth factor receptor 2; tra 89.87
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 89.56
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 89.46
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 89.4
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 89.34
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 89.23
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 89.21
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 89.07
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 88.74
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 88.65
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 88.47
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 88.45
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 88.26
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 88.21
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 87.99
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 87.93
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 87.92
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 87.81
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 87.75
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 87.4
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 87.32
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 87.25
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 87.14
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 87.13
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 87.09
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 87.05
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 86.81
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 86.76
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 86.66
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 86.53
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 86.48
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 86.46
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 86.32
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 86.32
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 86.28
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 86.21
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 86.17
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 86.08
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 86.07
2xir_A316 Vascular endothelial growth factor receptor 2; ang 85.77
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 85.76
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 85.62
3pls_A298 Macrophage-stimulating protein receptor; protein k 85.48
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 85.42
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 85.35
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 85.01
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 84.55
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 84.27
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 84.21
3lzb_A327 Epidermal growth factor receptor; epidermal growth 83.96
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 83.95
2a19_B284 Interferon-induced, double-stranded RNA-activated 83.94
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 83.92
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 83.77
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 83.72
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 83.57
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 83.41
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 82.61
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 82.46
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 82.04
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 81.49
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 81.04
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 80.94
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 80.23
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
Probab=96.96  E-value=0.001  Score=53.87  Aligned_cols=52  Identities=50%  Similarity=0.753  Sum_probs=43.2

Q ss_pred             cccccCCccCCCCcHHHHHHHHHHHHhhcCCCCCCCCCHhHHHHHhhcCCCC
Q 045421            4 LMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI   55 (169)
Q Consensus         4 l~eiVDprL~~~~~~eel~r~l~VALlC~~~~p~~RPtM~~VV~~L~g~~~~   55 (169)
                      +..++|..+...+..++...++.+...|++.+|.+||++.+|+++|++..-.
T Consensus       261 ~~~~~~~~~~~~~~~~~~~~l~~li~~cl~~dP~~Rps~~ell~~L~~~~~~  312 (326)
T 3uim_A          261 LEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLA  312 (326)
T ss_dssp             STTSSCTTCTTSCCHHHHHHHHHHHHHHTCSCGGGSCCHHHHHHHHHTSSCS
T ss_pred             hhhhcChhhccccCHHHHHHHHHHHHHHhCcCCccCCCHHHHHHHhcCcchh
Confidence            3455666666667788889999999999999999999999999999975433
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-09
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-08
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-07
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-07
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-06
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-06
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 4e-06
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-06
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-06
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 9e-06
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-05
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-05
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-05
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-05
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-05
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-05
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-05
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-05
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 7e-05
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-05
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-05
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-04
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-04
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: epha2 receptor tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.8 bits (123), Expect = 4e-09
 Identities = 9/60 (15%), Positives = 25/60 (41%)

Query: 4   LMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAS 63
           +M+ ++              + ++ + C     + RP  +++VS+L+     PD +   +
Sbjct: 222 VMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLA 281
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 94.84
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 94.77
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 94.02
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 93.84
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 93.77
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 93.5
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 93.23
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 93.19
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 92.45
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 92.06
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 91.86
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 91.85
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 91.83
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 91.76
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 91.33
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 90.13
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 89.13
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 87.95
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: epha2 receptor tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.84  E-value=0.0044  Score=48.41  Aligned_cols=34  Identities=18%  Similarity=0.424  Sum_probs=28.6

Q ss_pred             HHHHHHHHhhcCCCCCCCCCHhHHHHHhhcCCCC
Q 045421           22 ERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNI   55 (169)
Q Consensus        22 ~r~l~VALlC~~~~p~~RPtM~~VV~~L~g~~~~   55 (169)
                      ..+.+|...|.+.+|.+||+|.+|+++|+.....
T Consensus       240 ~~l~~li~~cl~~~p~~RPt~~eil~~L~~l~~~  273 (283)
T d1mqba_         240 SAIYQLMMQCWQQERARRPKFADIVSILDKLIRA  273 (283)
T ss_dssp             HHHHHHHHHHTCSSTTTSCCHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHCcCCHhHCcCHHHHHHHHHHHhhC
Confidence            4466788999999999999999999999865443
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure