BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045446
         (263 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ZUE|A Chain A, Rabbit Hemorrhagic Disease Virus (Rhdv)capsid Protein
 pdb|3ZUE|B Chain B, Rabbit Hemorrhagic Disease Virus (Rhdv)capsid Protein
 pdb|3ZUE|C Chain C, Rabbit Hemorrhagic Disease Virus (Rhdv)capsid Protein
          Length = 579

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 3   PFSFPTLPAAKWLGFVTAIWVQATCGNNYTFSNYSDALKSLMALTQLQ-LNNLSVAKDVG 61
           PF+ P +PAA W+GF  AIW   +   N T     +   +  A   LQ   N S A+ V 
Sbjct: 343 PFNGPGIPAAGWVGF-GAIWNSNSGAPNVTTVQAYELGFATGAPGNLQPTTNTSGAQTVA 401

Query: 62  KA-FGLLSGLASD 73
           K+ + +++G A +
Sbjct: 402 KSIYAVVTGTAQN 414


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,527,951
Number of Sequences: 62578
Number of extensions: 213969
Number of successful extensions: 470
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 470
Number of HSP's gapped (non-prelim): 1
length of query: 263
length of database: 14,973,337
effective HSP length: 97
effective length of query: 166
effective length of database: 8,903,271
effective search space: 1477942986
effective search space used: 1477942986
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)