BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 045448
(1756 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4EQI|A Chain A, Crystal Structure Of Serratia Fonticola Carbapenemase Sfc-1
pdb|4EQI|B Chain B, Crystal Structure Of Serratia Fonticola Carbapenemase Sfc-1
Length = 283
Score = 30.8 bits (68), Expect = 7.2, Method: Composition-based stats.
Identities = 16/69 (23%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
Query: 1540 NTSVRSQSKAVESKNPFSELEIEKELGVDKLEVSSSNADTNKEGSKRKILERLASDAQKL 1599
N +R ++ +E +P +E +I G+ E+S++ + G+ +LE+L + +
Sbjct: 70 NQRIRYDNRVMEPHSPVTEKQITT--GMTVAELSAATLQYSDNGAANLLLEKLIGGPEGM 127
Query: 1600 TSLQTTVQD 1608
TS ++ D
Sbjct: 128 TSFMRSIGD 136
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.309 0.127 0.330
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,962,350
Number of Sequences: 62578
Number of extensions: 1672330
Number of successful extensions: 5710
Number of sequences better than 100.0: 108
Number of HSP's better than 100.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 86
Number of HSP's that attempted gapping in prelim test: 5315
Number of HSP's gapped (non-prelim): 411
length of query: 1756
length of database: 14,973,337
effective HSP length: 112
effective length of query: 1644
effective length of database: 7,964,601
effective search space: 13093804044
effective search space used: 13093804044
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)