Query         045450
Match_columns 112
No_of_seqs    14 out of 16
Neff          1.6 
Searched_HMMs 46136
Date          Fri Mar 29 13:24:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045450.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045450hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00467 GS GS motif. Aa app  37.7      21 0.00046   21.0   1.2   20    8-27     11-30  (30)
  2 PF07862 Nif11:  Nitrogen fixat  31.7      28 0.00062   20.4   1.1   28   56-83     17-44  (49)
  3 PF08091 Toxin_21:  Spider inse  31.0      21 0.00046   22.5   0.5   17   91-107     5-21  (39)
  4 KOG2827 Uncharacterized conser  30.5      17 0.00036   31.2  -0.0   12   50-61    310-321 (322)
  5 smart00808 FABD F-actin bindin  28.0      76  0.0016   23.9   3.1   29   11-39     97-125 (126)
  6 PF05166 YcgL:  YcgL domain;  I  27.6      20 0.00044   24.5  -0.0   16   67-82     54-69  (74)
  7 PF02420 AFP:  Insect antifreez  24.7      44 0.00096   16.1   0.9   10   94-103     2-11  (12)
  8 PF05501 DUF755:  Domain of unk  22.2 2.2E+02  0.0048   20.6   4.5   30   15-44     32-61  (123)
  9 KOG3116 Predicted C3H1-type Zn  22.0      32 0.00069   27.4   0.2   23   74-96     20-45  (177)
 10 PF01666 DX:  DX module;  Inter  21.0      41  0.0009   22.6   0.5   27   72-103    33-59  (76)
 11 COG1198 PriA Primosomal protei  20.6      39 0.00085   31.0   0.4   42   54-95    405-448 (730)
 12 PF11193 DUF2812:  Protein of u  20.3      49  0.0011   21.8   0.8   28   67-94      5-32  (115)
 13 PF14620 YPEB:  YpeB sporulatio  20.0      53  0.0011   27.1   1.0   36   37-76     61-96  (361)

No 1  
>smart00467 GS GS motif. Aa approx. 30 amino acid motif that precedes the kinase domain in types I and II TGF beta receptors. Mutation of two or more of the serines or threonines in the TTSGSGSG of TGF-beta type I receptor impairs phosphorylation and signaling activity.
Probab=37.69  E-value=21  Score=21.03  Aligned_cols=20  Identities=35%  Similarity=0.237  Sum_probs=14.5

Q ss_pred             CCCCCCCCCchhhHHHHHHH
Q 045450            8 ASGSSSSREGTAKAMVFDQI   27 (112)
Q Consensus         8 ~~~sa~g~~~taka~VAeqI   27 (112)
                      ++||.+|..--.+-+||.||
T Consensus        11 tSGSGSG~p~LvqRTiarqi   30 (30)
T smart00467       11 TSGSGSGLPLLVQRTVARQI   30 (30)
T ss_pred             cCCCCCCchhHHHHHHhhhC
Confidence            45666666667888898876


No 2  
>PF07862 Nif11:  Nitrogen fixation protein of unknown function;  InterPro: IPR012903 This domain is found in the cyanobacteria, and the nitrogen-fixing proteobacterium Azotobacter vinelandii and may be involved in nitrogen fixation, but no role has been assigned []. 
Probab=31.74  E-value=28  Score=20.38  Aligned_cols=28  Identities=21%  Similarity=0.269  Sum_probs=22.4

Q ss_pred             hhHhhhhhccchhhhhhhhccCCCcccc
Q 045450           56 KNLLAKTTMIKNTGQVCIRADASGYFLP   83 (112)
Q Consensus        56 KnLLaK~s~~KnT~qvl~qlpA~Gyfl~   83 (112)
                      ..|..+...++|.++++.-+-..||.+-
T Consensus        17 ~~l~~~l~~~~~~~e~~~lA~~~Gy~ft   44 (49)
T PF07862_consen   17 PELREQLKACQNPEEVVALAREAGYDFT   44 (49)
T ss_pred             HHHHHHHHhcCCHHHHHHHHHHcCCCCC
Confidence            4566677778899999999889999863


No 3  
>PF08091 Toxin_21:  Spider insecticidal peptide;  InterPro: IPR012626 This family consists of insecticidal peptides isolated from venom of spiders of Aptostichus schlingeri (Trap-door spider) and Calisoga sp. Nine insecticidal peptides were isolated from the venom of the A. schlinger spider and seven of these toxins cause flaccid paralysis to insect larvae within 10 min of injection. However, all nine peptides were lethal within 24 hours [].; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=31.02  E-value=21  Score=22.54  Aligned_cols=17  Identities=35%  Similarity=0.884  Sum_probs=14.1

Q ss_pred             eeeecCCCCcccccccc
Q 045450           91 ITKCSSSQNCFPAACKY  107 (112)
Q Consensus        91 i~~cs~s~~c~~~~~ky  107 (112)
                      +.-|++|+||-++.|-|
T Consensus         5 ~~PC~ns~dCC~g~C~~   21 (39)
T PF08091_consen    5 RYPCSNSKDCCSGNCGY   21 (39)
T ss_pred             cccCCCchhhccCCccc
Confidence            45699999999998865


No 4  
>KOG2827 consensus Uncharacterized conserved protein [Function unknown]
Probab=30.54  E-value=17  Score=31.22  Aligned_cols=12  Identities=75%  Similarity=1.005  Sum_probs=10.4

Q ss_pred             hccccchhHhhh
Q 045450           50 QLTKLPKNLLAK   61 (112)
Q Consensus        50 ~L~kLPKnLLaK   61 (112)
                      +|-|||||||+|
T Consensus       310 ~~~~~pk~~l~~  321 (322)
T KOG2827|consen  310 PLDKLPKKLLAK  321 (322)
T ss_pred             ChhhhhHhhccC
Confidence            478999999987


No 5  
>smart00808 FABD F-actin binding domain (FABD). FABD is the F-actin binding domain of Bcr-Abl and its cellular counterpart c-Abl. The Bcr-Abl tyrosine kinase causes different forms of leukemia in humans. Depending on its position within the cell, Bcr-Abl differentially affects cellular growth. The FABD forms a compact left-handed four-helix bundle in solution.
Probab=28.03  E-value=76  Score=23.89  Aligned_cols=29  Identities=17%  Similarity=0.387  Sum_probs=23.6

Q ss_pred             CCCCCCchhhHHHHHHHHHHHhhhhHHHH
Q 045450           11 SSSSREGTAKAMVFDQISQTIQSTSNLLH   39 (112)
Q Consensus        11 sa~g~~~taka~VAeqIsQavqSTSNLLh   39 (112)
                      ++|+..+.+..-+..+.-++|+..||++|
T Consensus        97 sa~~~~~~~~~~~~~~l~~svkeIsdvVq  125 (126)
T smart00808       97 SAGSRNSPGATQDFSKLLSSVKEISDVVQ  125 (126)
T ss_pred             hccCCCCcchHHHHHHHHHHHHHHHHHhh
Confidence            56666677777888889999999999876


No 6  
>PF05166 YcgL:  YcgL domain;  InterPro: IPR007840 This family of proteins formerly called DUF709 includes the Escherichia coli gene ycgL. Homologues of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure []. The proteins in this entry are functionally uncharacterised.; PDB: 2H7A_A.
Probab=27.55  E-value=20  Score=24.47  Aligned_cols=16  Identities=19%  Similarity=0.553  Sum_probs=13.8

Q ss_pred             hhhhhhhhccCCCccc
Q 045450           67 NTGQVCIRADASGYFL   82 (112)
Q Consensus        67 nT~qvl~qlpA~Gyfl   82 (112)
                      +.++|++.|..+||||
T Consensus        54 d~~~V~~~l~~~GfyL   69 (74)
T PF05166_consen   54 DAEKVLAALEEQGFYL   69 (74)
T ss_dssp             -HHHHHHHHHHTSEEE
T ss_pred             CHHHHHHHHHhCCEEE
Confidence            6788999999999997


No 7  
>PF02420 AFP:  Insect antifreeze protein repeat;  InterPro: IPR003460 Antifreeze proteins (AFPs) are a class of proteins that are able to bind to and inhibit the growth of macromolecular ice, thereby permitting an organism to survive subzero temperatures by decreasing the probability of ice nucleation in their bodies []. These proteins have been characterised from a variety of organisms, including fish, plants, bacteria, fungi and arthropods. This entry represents insect AFPs of the type found in Tenebrio molitor (Yellow mealworm) and in Dendroides canadensis (Pyrochroid beetle). The structure of these AFPs consists of a right-handed beta-helix with 12 residues per coil. Each 12 residue-repeat contains two cys residues that form a disulphide bridge. The beta-helices of insect AFPs present a highly rigid array of threonine residues and bound water molecules that can effectively mimic the ice lattice. As such, beta-helical AFPs provide a more effective coverage of the ice surface compared to the alpha-helical fish AFPs []. A second insect antifreeze from Choristoneura fumiferana (Spruce budworm) (IPR007928 from INTERPRO) also consists of beta-helices, however in these proteins the helices form a left-handed twist; these proteins show no sequence homology to the current entry, but may act by a similar mechanism. The beta-helix motif may be used as an AFP structural motif in non-homologous proteins from other (non-fish) organisms as well.; PDB: 1EZG_B 1L1I_A.
Probab=24.65  E-value=44  Score=16.08  Aligned_cols=10  Identities=50%  Similarity=0.976  Sum_probs=8.1

Q ss_pred             ecCCCCcccc
Q 045450           94 CSSSQNCFPA  103 (112)
Q Consensus        94 cs~s~~c~~~  103 (112)
                      |..|.||..+
T Consensus         2 CT~s~~C~~a   11 (12)
T PF02420_consen    2 CTGSTNCNNA   11 (12)
T ss_dssp             EESSSTBTTS
T ss_pred             cccCCCCcCC
Confidence            7788999875


No 8  
>PF05501 DUF755:  Domain of unknown function (DUF755) ;  InterPro: IPR008474 This family is predominated by ORFs from Anelloviridae. The function of this family remains to be determined.
Probab=22.22  E-value=2.2e+02  Score=20.57  Aligned_cols=30  Identities=27%  Similarity=0.276  Sum_probs=24.6

Q ss_pred             CCchhhHHHHHHHHHHHhhhhHHHHHHhhc
Q 045450           15 REGTAKAMVFDQISQTIQSTSNLLHLMQQS   44 (112)
Q Consensus        15 ~~~taka~VAeqIsQavqSTSNLLhLMqqS   44 (112)
                      .|-+--+.++.|+.-.-+-|++|++|.+|-
T Consensus        32 ~GTsd~~~L~~qLlKEC~kt~~L~~l~~ql   61 (123)
T PF05501_consen   32 PGTSDVDSLQKQLLKECQKTSQLMQLLQQL   61 (123)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334445778999999999999999999876


No 9  
>KOG3116 consensus Predicted C3H1-type Zn-finger protein [General function prediction only]
Probab=22.05  E-value=32  Score=27.41  Aligned_cols=23  Identities=30%  Similarity=0.745  Sum_probs=16.1

Q ss_pred             hccCCCcccc--ccc-cccceeeecC
Q 045450           74 RADASGYFLP--RCT-CGEWITKCSS   96 (112)
Q Consensus        74 qlpA~Gyfl~--~ct-~~~Wi~~cs~   96 (112)
                      |+.|+|.-+.  +|+ +|||-.+|-.
T Consensus        20 qA~a~~~~~rCQKClq~GHWtYECk~   45 (177)
T KOG3116|consen   20 QASAVGSSARCQKCLQAGHWTYECKN   45 (177)
T ss_pred             hhhhcccchhHHHHHhhccceeeecC
Confidence            5556666554  565 7999999954


No 10 
>PF01666 DX:  DX module;  InterPro: IPR002593 This domain has no known function. It is found in several Caenorhabditis elegans proteins. The domain contains 6 conserved cysteines that probably form three disulphide bridges.
Probab=20.97  E-value=41  Score=22.56  Aligned_cols=27  Identities=15%  Similarity=0.119  Sum_probs=18.4

Q ss_pred             hhhccCCCccccccccccceeeecCCCCcccc
Q 045450           72 CIRADASGYFLPRCTCGEWITKCSSSQNCFPA  103 (112)
Q Consensus        72 l~qlpA~Gyfl~~ct~~~Wi~~cs~s~~c~~~  103 (112)
                      |-+...+|=++    +..| ..|++..||+++
T Consensus        33 mG~~~~~g~~~----~~~~-~~C~~N~DC~~~   59 (76)
T PF01666_consen   33 MGEENFNGQEN----KELE-SYCTSNRDCGSG   59 (76)
T ss_pred             EeeeccCCcEe----Eeec-cccccCcccCCC
Confidence            33444555443    4556 899999999986


No 11 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=20.59  E-value=39  Score=31.01  Aligned_cols=42  Identities=26%  Similarity=0.441  Sum_probs=32.8

Q ss_pred             cchhHhhhh-hccchhhhhhhhccCCCcc-ccccccccceeeec
Q 045450           54 LPKNLLAKT-TMIKNTGQVCIRADASGYF-LPRCTCGEWITKCS   95 (112)
Q Consensus        54 LPKnLLaK~-s~~KnT~qvl~qlpA~Gyf-l~~ct~~~Wi~~cs   95 (112)
                      |++-||.+. .+...-+|||-.|+..||+ +.-|--=.|+++|-
T Consensus       405 lS~~Ll~~i~~~l~~geQ~llflnRRGys~~l~C~~Cg~v~~Cp  448 (730)
T COG1198         405 LSPALLEAIRKTLERGEQVLLFLNRRGYAPLLLCRDCGYIAECP  448 (730)
T ss_pred             CCHHHHHHHHHHHhcCCeEEEEEccCCccceeecccCCCcccCC
Confidence            667777765 3455668999999999998 66777778998884


No 12 
>PF11193 DUF2812:  Protein of unknown function (DUF2812);  InterPro: IPR021359  This is a bacterial family of uncharacterised proteins, however some members of this family are annotated as membrane proteins. 
Probab=20.29  E-value=49  Score=21.82  Aligned_cols=28  Identities=14%  Similarity=0.048  Sum_probs=23.3

Q ss_pred             hhhhhhhhccCCCccccccccccceeee
Q 045450           67 NTGQVCIRADASGYFLPRCTCGEWITKC   94 (112)
Q Consensus        67 nT~qvl~qlpA~Gyfl~~ct~~~Wi~~c   94 (112)
                      -.++-|+++-++||+|.+....-|+|+=
T Consensus         5 ~~E~wL~ema~kGw~l~~~~~~~~~F~k   32 (115)
T PF11193_consen    5 KEEQWLNEMAAKGWHLKKIGGFGYTFEK   32 (115)
T ss_pred             HHHHHHHHHHHCCCeEEEecceEEEEEE
Confidence            3578899999999999988887788763


No 13 
>PF14620 YPEB:  YpeB sporulation
Probab=20.05  E-value=53  Score=27.13  Aligned_cols=36  Identities=22%  Similarity=0.317  Sum_probs=29.2

Q ss_pred             HHHHHhhcCcchhhccccchhHhhhhhccchhhhhhhhcc
Q 045450           37 LLHLMQQSSPSQVQLTKLPKNLLAKTTMIKNTGQVCIRAD   76 (112)
Q Consensus        37 LLhLMqqSSpaqa~L~kLPKnLLaK~s~~KnT~qvl~qlp   76 (112)
                      |-.+-+++|-||..|..||=.++.    .-||+..|.|+-
T Consensus        61 l~~vwr~a~~A~~~l~qLPl~~~~----~~~t~~FLsqvG   96 (361)
T PF14620_consen   61 LAEVWRQASEAQNDLGQLPLSQMP----FNKTEKFLSQVG   96 (361)
T ss_pred             HHHHHHHHHHHHHHHHhCCCCCcc----hhHHHHHHHHHH
Confidence            445667899999999999988765    678888888875


Done!