Citrus Sinensis ID: 045454

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---

CCRRDVEEDDDECRDHVEFASKNVHLITTMVSWEAKVSESIKDGKIVVANFSAQWCSPCKKIAPVYIQLADKYPSMICLTVDVDELPEFSNSWGVTATPTFFFLKDGRQIDKLIGSNKLELQRKTAAVSKLLR

cccccccccccccccccccccccEEEEEEHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHc

******************F*SKNVHLITTMVSWEAKVSESIKDGKIVVANFSAQWCSPCKKIAPVYIQLADKYPSMICLTVDVDELPEFSNSWGVTATPTFFFLKDGRQIDKLIGSNKLELQRKTAAVSK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

CCRRDVEEDDDECRDHVEFASKNVHLITTMVSWEAKVSESIKDGKIVVANFSAQWCSPCKKIAPVYIQLADKYPSMICLTVDVDELPEFSNSWGVTATPTFFFLKDGRQIDKLIGSNKLELQRKTAAVSKLLR

Annotation	Function Description	Confidence Level	Reference Protein
Thioredoxin H9	Probable thiol-disulfide oxidoreductase that may play a role in intercellular communication due to its ability to move from cell to cell.	probable	Q9C9Y6
Thioredoxin H4-1	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	probable	Q9AS75
Thioredoxin H-type	Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide. The H form is known to activate a number of cytosolic enzymes.	probable	P85801

No EC number assigned to the protein, probably not an enzyme!

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 24-131
View the alignment between query and template
View the model in PyMOL