Citrus Sinensis ID: 045493

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------105
VVSINLTGSNLKGTLQEFPFLLFPQLAYLDLSVNQLFGTIPTQISHLSKLKHLDFSTNQFSGIIPPQIGILTNLVVLRLSVNQLNGLIPEELGELTSLNELALSYNRLNGSIPASLGNLSNLVQLSLSNNSLSGQIPPNWGYLISPHYGSIPQDLGNLESPVSVSLHTNNFSGVIPRSLGGLKNLTFVYLNNNRIVGSIPSEIGNLRSLSYLGLNKNQLSGSIPPTAGNLSNLKFLYLHDNRLSGYIPPKLGSFKSLLYLYLSHNQLNGSLPSSFGNLSSLKHLHVHNINKLSGSIPKEIGNLKSLSHLWLSKTQLSGFIPPSLGNLSNIRGLYIRENMLYGSIPEELGRLKSLSQLSLSVNKLNGSIPHCLGNLSNLKFFALRENELSGSIPQEIENMKKLNKYLLFENQFTGYLPQNVCQSGSLTHFSVRNNNFVGPIPRSLQNCTSLYSLRLERNQLTGNISEVFGIYPDLELLDLSNNNFFGEISSNWIKCPQLATLNMGGNEISGTIPSEIGNMTQLHKLDFSSNRLVGQIPKQLGKLTSLTSLTLNGNQLSGDIPLELGLLAELGYLDLSANRLSKLIPKNLGELRKLHHLNLSNNQFSQEISIQIGKLVQLSKLDLSHNSLGGNIPSEICNLESLEYMNLLQNKLSGPIPSCFRRMHGLSSIDVSYNELQGSIPHSKAFQNATIEAFQGNKELCGDVTGLPPCEALTSNKGDSGKHMTFLFVIVPLLSGAFLLSLVLIGMCFNFRRRKRTDSQEGQNDVNNQELLSASTFEGKMVLHGTGGCGTVYKAELTSGDTRAVKKLHSLPTGEIGINQKGFVSEITEIRHRNIVKFYGFCSHTQHLFLVYEYLERGSLATILSNEATAAELDWSKRVNVIKGVANALSYMHHDCFPPILHRDISSKKVLLDLEYKAHVSDFGTAKFLKPDSSNWSELAGTCGYIAPELAYTMRANEKCDVFNFGVLVLEVIEGKHPGHFLSLLLSLPAPAANMNIVVNDLIDSRLPPPLGEVEEKLKSMIAVAFLCLDANPDCRPTMQKVCNLLCR
cCEEEccccccCECcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccEEEECccccccccccccEEEccccccccccccccccccccccccccccccccccccEEEccccccECcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccccccccccCEECcccHHcccccccccccccccccEEcccccccccccccEEEccccEEECcccccHHccccccEEcccccCEEEEccccccccccccEEEcccccccccccHHHcccccccEEEccccCCcccccccccccccccEEEccccccCCcccccccccccccEEEccccCEEECccccHHccccccEEEccccccECcccccccccccccEEEcccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHcccccccccccccccccccHHHHHccccccccccccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccccccEEECccccEEEEEECccccEEEEEEEcccccccccccHHHHHHHHHHccccccccEEEEEEcccccEEEEcccccccHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHc
VVSINLTGSNLKGTLQEFPFLLFPQLAYLDLSVNQLFGTIPTQISHLSKLKHLDFSTNQFSGIIPPQIGILTNLVVLRLSVNQLNGLIPEELGELTSLNELALSYNRLNGSIPASLGNLSNLVQLSLSNNSLSGQIPPNWGYLISPHYGSIPQDLGNLESPVSVSLHTNNFSGVIPRSLGGLKNLTFVYLNNNRIVGSIPSEIGNLRSLSYLGLNKNQLSGSIPPTAGNLSNLKFLYLHDNRLSGYIPPKLGSFKSLLYLYLSHNQLNGSLPSSFGNLSSLKHLHVHNINKLSGSIPKEIGNLKSLSHLWLSKTQLSGFIPPSLGNLSNIRGLYIRENMLYGSIPEELGRLKSLSQLSLSVNKLNGSIPHCLGNLSNLKFFALRENELSGSIPQEIENMKKLNKYLLFENQFTGYLPQNVCQSGSLTHFSVRNNNFVGPIPRSLQNCTSLYSLRLERNQLTGNISEVFGIYPDLELLDLSNNNFFGEISSNWIKCPQLATLNMGGNEISGTIPSEIGNMTQLHKLDFSSNRLVGQIPKQLGKLTSLTSLTLNGNQLSGDIPLELGLLAELGYLDLSANRLSKLIPKNLGELRKLHHLNLSNNQFSQEISIQIGKLVQLSKLDLSHNSLGGNIPSEICNLESLEYMNLLQNKLSGPIPSCFRRMHGLSSIDVSYNELQGSIPHSKAFQNATIEAFQGNKELCGDVTGLPPCE*******DSGKHMTFLFVIVPLLSGAFLLSLVLIGMCFNFR****************QELLSASTFEGKMVLHGTGGCGTVYKAELTSGDTRAVKKLHSLPTGEIGINQKGFVSEITEIRHRNIVKFYGFCSHTQHLFLVYEYLERGSLATILSNEATAAELDWSKRVNVIKGVANALSYMHHDCFPPILHRDISSKKVLLDLEYKAHVSDFGTAKFLKPDSSNWSELAGTCGYIAPELAYTMRANEKCDVFNFGVLVLEVIEGKHPGHFLSLLLSLPAPAANMNIVVNDLIDSRLPPPLGEVEEKLKSMIAVAFLCLDANPDCRPTMQKVCNLLCR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VVSINLTGSNLKGTLQEFPFLLFPQLAYLDLSVNQLFGTIPTQISHLSKLKHLDFSTNQFSGIIPPQIGILTNLVVLRLSVNQLNGLIPEELGELTSLNELALSYNRLNGSIPASLGNLSNLVQLSLSNNSLSGQIPPNWGYLISPHYGSIPQDLGNLESPVSVSLHTNNFSGVIPRSLGGLKNLTFVYLNNNRIVGSIPSEIGNLRSLSYLGLNKNQLSGSIPPTAGNLSNLKFLYLHDNRLSGYIPPKLGSFKSLLYLYLSHNQLNGSLPSSFGNLSSLKHLHVHNINKLSGSIPKEIGNLKSLSHLWLSKTQLSGFIPPSLGNLSNIRGLYIRENMLYGSIPEELGRLKSLSQLSLSVNKLNGSIPHCLGNLSNLKFFALRENELSGSIPQEIENMKKLNKYLLFENQFTGYLPQNVCQSGSLTHFSVRNNNFVGPIPRSLQNCTSLYSLRLERNQLTGNISEVFGIYPDLELLDLSNNNFFGEISSNWIKCPQLATLNMGGNEISGTIPSEIGNMTQLHKLDFSSNRLVGQIPKQLGKLTSLTSLTLNGNQLSGDIPLELGLLAELGYLDLSANRLSKLIPKNLGELRKLHHLNLSNNQFSQEISIQIGKLVQLSKLDLSHNSLGGNIPSEICNLESLEYMNLLQNKLSGPIPSCFRRMHGLSSIDVSYNELQGSIPHSKAFQNATIEAFQGNKELCGDVTGLPPCEALTSNKGDSGKHMTFLFVIVPLLSGAFLLSLVLIGMCFNFRRRKRTDSQEGQNDVNNQELLSASTFEGKMVLHGTGGCGTVYKAELTSGDTRAVKKLHSLPTGEIGINQKGFVSEITEIRHRNIVKFYGFCSHTQHLFLVYEYLERGSLATILSNEATAAELDWSKRVNVIKGVANALSYMHHDCFPPILHRDISSKKVLLDLEYKAHVSDFGTAKFLKPDSSNWSELAGTCGYIAPELAYTMRANEKCDVFNFGVLVLEVIEGKHPGHFLSLLLSLPAPAANMNIVVNDLIDSRLPPPLGEVEEKLKSMIAVAFLCLDANPDCRPTMQKVCNLLCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable leucine-rich repeat receptor-like protein kinase At1g35710 probableQ9LP24

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IFG, chain A
Confidence level:very confident
Coverage over the Query: 27-133
View the alignment between query and template
View the model in PyMOL
Template: 2IFG, chain A
Confidence level:very confident
Coverage over the Query: 548-654
View the alignment between query and template
View the model in PyMOL
Template: 2JE0, chain A
Confidence level:very confident
Coverage over the Query: 519-648
View the alignment between query and template
View the model in PyMOL
Template: 2JE0, chain A
Confidence level:very confident
Coverage over the Query: 496-624
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 448-710
View the alignment between query and template
View the model in PyMOL
Template: 1OZN, chain A
Confidence level:very confident
Coverage over the Query: 3-136,152-244
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 424-679
View the alignment between query and template
View the model in PyMOL
Template: 3O53, chain A
Confidence level:very confident
Coverage over the Query: 334-397,422-624
View the alignment between query and template
View the model in PyMOL
Template: 1WWL, chain A
Confidence level:very confident
Coverage over the Query: 399-605
View the alignment between query and template
View the model in PyMOL
Template: 3G06, chain A
Confidence level:very confident
Coverage over the Query: 25-133,173-272,298-401
View the alignment between query and template
View the model in PyMOL
Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 15-131,195-288,301-328,350-403,428-682
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 767-1048
View the alignment between query and template
View the model in PyMOL
Template: 3RGX, chain A
Confidence level:confident
Coverage over the Query: 29-124,143-414,439-484,509-711
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 729-758
View the alignment between query and template
View the model in PyMOL