BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 045494
(492 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2GK9|A Chain A, Human Phosphatidylinositol-4-Phosphate 5-Kinase, Type Ii,
Gamma
pdb|2GK9|B Chain B, Human Phosphatidylinositol-4-Phosphate 5-Kinase, Type Ii,
Gamma
pdb|2GK9|C Chain C, Human Phosphatidylinositol-4-Phosphate 5-Kinase, Type Ii,
Gamma
pdb|2GK9|D Chain D, Human Phosphatidylinositol-4-Phosphate 5-Kinase, Type Ii,
Gamma
Length = 392
Score = 30.0 bits (66), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 6/51 (11%)
Query: 77 SSTNNADHGLQPDHHHTTIGPCEDNSIIPSVLGDLRPRKMMRISYDGEESF 127
SS + AD ++H I C N+++P LG M R+S D E+S+
Sbjct: 126 SSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLG------MYRVSVDNEDSY 170
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.135 0.425
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,928,490
Number of Sequences: 62578
Number of extensions: 661746
Number of successful extensions: 1441
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1441
Number of HSP's gapped (non-prelim): 5
length of query: 492
length of database: 14,973,337
effective HSP length: 103
effective length of query: 389
effective length of database: 8,527,803
effective search space: 3317315367
effective search space used: 3317315367
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)