Query         045506
Match_columns 173
No_of_seqs    105 out of 169
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 02:48:38 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045506.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045506hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04674 Phi_1:  Phosphate-indu 100.0 3.7E-66 8.1E-71  446.8  12.7  134   33-173     1-166 (273)
  2 PF14053 DUF4248:  Domain of un  31.8      29 0.00062   24.7   1.4   48    7-67     13-66  (69)
  3 TIGR03872 cytochrome_MoxG cyto  30.0      49  0.0011   26.0   2.6   23   50-72    101-123 (133)
  4 PF14969 DUF4508:  Domain of un  28.6      20 0.00044   27.5   0.2   20   50-72     10-29  (98)
  5 COG3411 Ferredoxin [Energy pro  28.6      89  0.0019   22.4   3.4   28   27-65     15-42  (64)
  6 PF07172 GRP:  Glycine rich pro  27.0      57  0.0012   24.5   2.3   10   13-22     19-28  (95)
  7 PF08741 YwhD:  YwhD family;  I  26.7      50  0.0011   27.5   2.1   19   54-72    130-148 (163)
  8 PF06999 Suc_Fer-like:  Sucrase  25.8      85  0.0018   25.8   3.4   36   31-66    172-214 (230)
  9 PF02921 UCR_TM:  Ubiquinol cyt  23.9      57  0.0012   22.8   1.7   15   58-72     47-61  (64)
 10 PF13240 zinc_ribbon_2:  zinc-r  23.6      43 0.00093   19.0   0.9   16  123-139     6-21  (23)
 11 PF00034 Cytochrom_C:  Cytochro  22.5      79  0.0017   20.5   2.2   17   54-70     74-90  (91)
 12 PF07293 DUF1450:  Protein of u  22.1      53  0.0011   24.0   1.3   21  130-155    33-53  (78)
 13 PF07473 Toxin_11:  Spasmodic p  21.5      47   0.001   20.3   0.8    9  132-140     1-9   (28)
 14 PF08098 ATX_III:  Anemonia sul  20.8      45 0.00097   20.1   0.6    8  160-167    15-23  (27)
 15 PF14832 Tautomerase_3:  Putati  20.8   1E+02  0.0022   24.5   2.7   26   46-71      2-29  (136)
 16 cd03062 TRX_Fd_Sucrase TRX-lik  20.2      86  0.0019   23.0   2.1   18   48-65     63-80  (97)
 17 PF13873 Myb_DNA-bind_5:  Myb/S  20.2      85  0.0018   21.4   2.0   16   54-69      4-19  (78)
 18 PF09889 DUF2116:  Uncharacteri  20.0      28 0.00061   24.3  -0.5   16  123-138    10-25  (59)

No 1  
>PF04674 Phi_1:  Phosphate-induced protein 1 conserved region;  InterPro: IPR006766 This entry represents a family of conserved plant proteins. A conserved region in these proteins was identified in a phosphate-induced protein of unknown function [].
Probab=100.00  E-value=3.7e-66  Score=446.83  Aligned_cols=134  Identities=56%  Similarity=1.099  Sum_probs=127.5

Q ss_pred             eeecCCcceecceeEEEEEeecCChhhHhHHHHHHHhcCcccccCCCCCCCCCCchhhhhhhhHHhhhccCCCc-eeEEe
Q 045506           33 MTYHKGALLEGNLPVSILWYGEFSPAQKSIIADFLLSLNPQKNQLGSHFTTPQPSVSKRWHTIQTYMKKAGKGQ-TRVFI  111 (173)
Q Consensus        33 l~YH~GplLtg~i~V~lIwYG~ftp~QksiI~DFl~SLs~~~~~~~~~~~~~~PSVs~WW~t~~~Y~~~~~~~v-~~v~l  111 (173)
                      |+|||||||+|+|+|||||||+|+|+||+||+|||+||++       +++++.|||++||+|+++|++++++++ .+|+|
T Consensus         1 L~YH~GplLtg~i~V~lIWYG~ftp~QkaiI~DFl~SLs~-------~~~~~~PSVa~WW~t~~~Y~~~~~~~~~~~v~l   73 (273)
T PF04674_consen    1 LTYHGGPLLTGNINVYLIWYGRFTPAQKAIIRDFLRSLSS-------SAPAPSPSVAQWWKTTEKYYDQAGANVSGRVVL   73 (273)
T ss_pred             CCCCCCceeecCeeEEEEEeeCCCHHHHHHHHHHHHhcCC-------CCCCCCCChhhhhhhHHhhcccccccccceEEE
Confidence            7999999999999999999999999999999999999998       434789999999999999999999988 99999


Q ss_pred             eeEEecCCCCCCCCcccc---------------------------CCcccccccCCCCC----CCCceeEEEecCCCCCC
Q 045506          112 ASQFSDKNCSLGKILKKA---------------------------QGFCMSNCGFHGSN----PQHNSAFIWVGNSVTPC  160 (173)
Q Consensus       112 ~~qv~D~~ySlGKsL~~~---------------------------~gFC~s~CG~H~~~----~~~~~~YaWVGNs~~qC  160 (173)
                      |+|+.|++|||||+|++.                           |||||++||+|++.    .+.+++|+||||||+||
T Consensus        74 ~~qv~D~~ySlGksL~~~~i~~lv~~~~~~~~gvylVLTa~DV~v~gFC~~~CG~H~~~~~~~~~~~~~YawVGns~~qC  153 (273)
T PF04674_consen   74 GGQVSDENYSLGKSLSRSQIQQLVAKAIPDPNGVYLVLTAADVAVEGFCMSRCGFHGSTFPSSVGKRLPYAWVGNSETQC  153 (273)
T ss_pred             eeEEecCCCCCCcccCHHHHHHHHHhcCCCCCceEEEEecccceecccccccccCCcCCcccccccceeEEEecCccCCC
Confidence            999999999999999988                           99999999999985    34689999999999999


Q ss_pred             CCCCCCCCCCCCC
Q 045506          161 PGQCAWPFHQPIY  173 (173)
Q Consensus       161 PG~CAwPFh~P~Y  173 (173)
                      ||+||||||||+|
T Consensus       154 Pg~CAwPf~~p~y  166 (273)
T PF04674_consen  154 PGQCAWPFHQPIY  166 (273)
T ss_pred             CCCCCCCCccccc
Confidence            9999999999998


No 2  
>PF14053 DUF4248:  Domain of unknown function (DUF4248)
Probab=31.84  E-value=29  Score=24.67  Aligned_cols=48  Identities=27%  Similarity=0.413  Sum_probs=28.8

Q ss_pred             HHHHHHhhhhhchhhhccccCCCCc------eeeecCCcceecceeEEEEEeecCChhhHhHHHHHH
Q 045506            7 LLHLNFISSCLGARKLTSLYQPSPI------AMTYHKGALLEGNLPVSILWYGEFSPAQKSIIADFL   67 (173)
Q Consensus         7 ~~~~~~~~~~~~~r~l~~lv~~~p~------~l~YH~GplLtg~i~V~lIwYG~ftp~QksiI~DFl   67 (173)
                      ++-.+......|.|+|..-+...|.      ..-||.+.          -   .|||.|..+|.++|
T Consensus        13 ~lYfP~~~~~sA~r~L~rwI~~~~~L~~~L~~~Gy~~~~----------r---~~TP~QV~lIv~~L   66 (69)
T PF14053_consen   13 QLYFPDLTPSSAVRKLRRWIRRNPELLEELEATGYHPRQ----------R---SFTPRQVRLIVRYL   66 (69)
T ss_pred             HHHcCCCCHHHHHHHHHHHHHHCHHHHHHHHHcCCCCCC----------E---ecCHHHHHHHHHHc
Confidence            3444445556667777665544432      13344332          1   28999999999986


No 3  
>TIGR03872 cytochrome_MoxG cytochrome c(L), periplasmic. This model describes a periplasmic c-type cytochrome that serves as the primary electron acceptor for the quinoprotein methanol dehydrogenase, a PQQ enzyme. The member from Paracoccus denitrificans is also characterized as an electron acceptor for methylamine dehydrogenase, a tryptophan tryptophylquinone enzyme. This protein is called cytochrome c(L) in methylotrophic bacteria such Methylobacterium extorquens, but c551i in Paracoccus denitrificans.
Probab=30.04  E-value=49  Score=26.00  Aligned_cols=23  Identities=17%  Similarity=0.251  Sum_probs=20.1

Q ss_pred             EEeecCChhhHhHHHHHHHhcCc
Q 045506           50 LWYGEFSPAQKSIIADFLLSLNP   72 (173)
Q Consensus        50 IwYG~ftp~QksiI~DFl~SLs~   72 (173)
                      -|-+.+++.|...|.+||++|..
T Consensus       101 ~~~~~LsdeeI~aLaaYI~sl~~  123 (133)
T TIGR03872       101 PQYGNLTLDEMLQIMAWIRHLYT  123 (133)
T ss_pred             ccccCCCHHHHHHHHHHHHHhCC
Confidence            46678999999999999999965


No 4  
>PF14969 DUF4508:  Domain of unknown function (DUF4508)
Probab=28.62  E-value=20  Score=27.50  Aligned_cols=20  Identities=40%  Similarity=0.765  Sum_probs=16.7

Q ss_pred             EEeecCChhhHhHHHHHHHhcCc
Q 045506           50 LWYGEFSPAQKSIIADFLLSLNP   72 (173)
Q Consensus        50 IwYG~ftp~QksiI~DFl~SLs~   72 (173)
                      -||+.|+..||.   |||.-|-.
T Consensus        10 ~WF~~WS~~QRe---~Fl~~Lv~   29 (98)
T PF14969_consen   10 QWFQEWSELQRE---DFLQDLVE   29 (98)
T ss_pred             HHHHhcCHHHHH---HHHHHHHH
Confidence            499999999998   88777754


No 5  
>COG3411 Ferredoxin [Energy production and conversion]
Probab=28.58  E-value=89  Score=22.35  Aligned_cols=28  Identities=29%  Similarity=0.741  Sum_probs=19.1

Q ss_pred             CCCCceeeecCCcceecceeEEEEEeecCChhhHhHHHH
Q 045506           27 QPSPIAMTYHKGALLEGNLPVSILWYGEFSPAQKSIIAD   65 (173)
Q Consensus        27 ~~~p~~l~YH~GplLtg~i~V~lIwYG~ftp~QksiI~D   65 (173)
                      +.-|+.+.|-.|           +||++-+|..-.-|+|
T Consensus        15 ~~gPvl~vYpeg-----------vWY~~V~p~~a~rIv~   42 (64)
T COG3411          15 QDGPVLVVYPEG-----------VWYTRVDPEDARRIVQ   42 (64)
T ss_pred             ccCCEEEEecCC-----------eeEeccCHHHHHHHHH
Confidence            444666777766           9999999975443333


No 6  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=26.95  E-value=57  Score=24.48  Aligned_cols=10  Identities=60%  Similarity=0.667  Sum_probs=5.1

Q ss_pred             hhhhhchhhh
Q 045506           13 ISSCLGARKL   22 (173)
Q Consensus        13 ~~~~~~~r~l   22 (173)
                      +....++|++
T Consensus        19 isSevaa~~~   28 (95)
T PF07172_consen   19 ISSEVAAREL   28 (95)
T ss_pred             HHhhhhhHHh
Confidence            3334556665


No 7  
>PF08741 YwhD:  YwhD family;  InterPro: IPR014852 The members of this entry are currently uncharacterised. They are around 170 amino acids in length. 
Probab=26.66  E-value=50  Score=27.54  Aligned_cols=19  Identities=42%  Similarity=0.663  Sum_probs=16.5

Q ss_pred             cCChhhHhHHHHHHHhcCc
Q 045506           54 EFSPAQKSIIADFLLSLNP   72 (173)
Q Consensus        54 ~ftp~QksiI~DFl~SLs~   72 (173)
                      .-...+|+++.|||.+.++
T Consensus       130 ~md~~sk~~L~~fL~~h~~  148 (163)
T PF08741_consen  130 HMDDESKKILADFLKEHNP  148 (163)
T ss_pred             cCCHHHHHHHHHHHHHcCH
Confidence            4578999999999999875


No 8  
>PF06999 Suc_Fer-like:  Sucrase/ferredoxin-like;  InterPro: IPR009737 This family contains a number of bacterial and eukaryotic proteins approximately 400 residues long that resemble ferredoxin and appear to have sucrolytic activity [].
Probab=25.77  E-value=85  Score=25.83  Aligned_cols=36  Identities=28%  Similarity=0.504  Sum_probs=28.5

Q ss_pred             ceeeec-CCcceecceeEE------EEEeecCChhhHhHHHHH
Q 045506           31 IAMTYH-KGALLEGNLPVS------ILWYGEFSPAQKSIIADF   66 (173)
Q Consensus        31 ~~l~YH-~GplLtg~i~V~------lIwYG~ftp~QksiI~DF   66 (173)
                      +-..=| ||-=..||+=||      -+|||+-+|.+=..|.|-
T Consensus       172 V~~iSHiGGHkfAgNvIiy~~~~p~g~wyGrv~p~~v~~iv~~  214 (230)
T PF06999_consen  172 VWEISHIGGHKFAGNVIIYSKPKPDGIWYGRVTPEDVEGIVDA  214 (230)
T ss_pred             EEEecccccceecCeEEEEecCCCcEEEEEeeCHHHHHHHHHH
Confidence            555566 888888998888      599999999877766665


No 9  
>PF02921 UCR_TM:  Ubiquinol cytochrome reductase transmembrane region;  InterPro: IPR004192 The ubiquinol cytochrome c reductase (cytochrome bc1) complex is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The bc1 complex contains 11 subunits, 3 respiratory subunits (cytochrome B, cytochrome C1, Rieske protein), 2 core proteins and 6 low-molecular weight proteins. Each subunit of the cytochrome bc1 complex provides a single helix (this domain) to make up the transmembrane region of the complex.; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0055114 oxidation-reduction process; PDB: 1NU1_E 1L0L_E 1BCC_E 1SQB_E 1SQQ_E 1SQP_E 1PPJ_E 2A06_R 1BE3_E 1BGY_E ....
Probab=23.94  E-value=57  Score=22.81  Aligned_cols=15  Identities=40%  Similarity=0.612  Sum_probs=13.1

Q ss_pred             hhHhHHHHHHHhcCc
Q 045506           58 AQKSIIADFLLSLNP   72 (173)
Q Consensus        58 ~QksiI~DFl~SLs~   72 (173)
                      .-|++|.|||.++++
T Consensus        47 ~AK~~V~~fv~~mSa   61 (64)
T PF02921_consen   47 AAKSTVQDFVSSMSA   61 (64)
T ss_dssp             HHHHHHHHHHHTTSS
T ss_pred             HHHHHHHHHHHhcCc
Confidence            458999999999986


No 10 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=23.60  E-value=43  Score=18.96  Aligned_cols=16  Identities=38%  Similarity=0.937  Sum_probs=9.2

Q ss_pred             CCCccccCCcccccccC
Q 045506          123 GKILKKAQGFCMSNCGF  139 (173)
Q Consensus       123 GKsL~~~~gFC~s~CG~  139 (173)
                      |+.+.....|| .+||+
T Consensus         6 G~~~~~~~~fC-~~CG~   21 (23)
T PF13240_consen    6 GAEIEDDAKFC-PNCGT   21 (23)
T ss_pred             CCCCCCcCcch-hhhCC
Confidence            45555556777 45663


No 11 
>PF00034 Cytochrom_C:  Cytochrome c;  InterPro: IPR003088 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes. Ambler [] recognised four classes of cytC. Class I includes the low-spin soluble cytC of mitochondria and bacteria, with the haem-attachment site towards the N terminus, and the sixth ligand provided by a methionine residue about 40 residues further on towards the C terminus. On the basis of sequence similarity, class I cytC were further subdivided into five classes, IA to IE. Class IB includes the eukaryotic mitochondrial cytC and prokaryotic 'short' cyt c2 exemplified by Rhodopila globiformis cyt c2; class IA includes 'long' cyt c2, such as Rhodospirillum rubrum cyt c2 and Aquaspirillum itersonii cyt c-550, which have several extra loops by comparison with class IB cytC.; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1YNR_B 2AI5_A 1AYG_A 3O5C_C 1YEA_A 3CXH_W 1YTC_A 1YEB_A 2YBB_Y 2B4Z_A ....
Probab=22.52  E-value=79  Score=20.48  Aligned_cols=17  Identities=29%  Similarity=0.309  Sum_probs=15.8

Q ss_pred             cCChhhHhHHHHHHHhc
Q 045506           54 EFSPAQKSIIADFLLSL   70 (173)
Q Consensus        54 ~ftp~QksiI~DFl~SL   70 (173)
                      .+|+.|..-|.+||+||
T Consensus        74 ~ls~~e~~~l~ayl~sl   90 (91)
T PF00034_consen   74 ILSDEEIADLAAYLRSL   90 (91)
T ss_dssp             TSSHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHh
Confidence            78999999999999987


No 12 
>PF07293 DUF1450:  Protein of unknown function (DUF1450);  InterPro: IPR009910 This entry consists of several hypothetical bacterial proteins of around 80 residues in length representing two families. Members contain four highly conserved cysteine residues and their function is unknown.
Probab=22.06  E-value=53  Score=24.02  Aligned_cols=21  Identities=29%  Similarity=0.471  Sum_probs=15.0

Q ss_pred             CCcccccccCCCCCCCCceeEEEecC
Q 045506          130 QGFCMSNCGFHGSNPQHNSAFIWVGN  155 (173)
Q Consensus       130 ~gFC~s~CG~H~~~~~~~~~YaWVGN  155 (173)
                      +-=|.++||-     -..-|||.|.+
T Consensus        33 e~gCl~~Cg~-----C~~~pFAlVnG   53 (78)
T PF07293_consen   33 EYGCLSYCGP-----CAKKPFALVNG   53 (78)
T ss_pred             EcChhhhCcC-----CCCCccEEECC
Confidence            4569999993     34568888864


No 13 
>PF07473 Toxin_11:  Spasmodic peptide gm9a;  InterPro: IPR010012 This family consists of several spasmodic peptide gm9a sequences. Conotoxin gm9a is a putative 27-residue polypeptide encoded by Conus gloriamaris and is known to be a homologue of the 'spasmodic peptide', tx9a, isolated from the venom of the mollusk-hunting cone shell Conus textile []. Upon injection of this venom component, normal mice are converted into behavioural phenocopies of a well-known mutant, the spasmodic mouse [].; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1IXT_A.
Probab=21.53  E-value=47  Score=20.25  Aligned_cols=9  Identities=33%  Similarity=0.815  Sum_probs=2.6

Q ss_pred             cccccccCC
Q 045506          132 FCMSNCGFH  140 (173)
Q Consensus       132 FC~s~CG~H  140 (173)
                      ||-+.|-.|
T Consensus         1 sCnnsCqsh    9 (28)
T PF07473_consen    1 SCNNSCQSH    9 (28)
T ss_dssp             ---B--SSS
T ss_pred             Ccchhhhhh
Confidence            566667666


No 14 
>PF08098 ATX_III:  Anemonia sulcata toxin III family;  InterPro: IPR012509 This entry occurs within the Anemonia sulcata toxin III (ATX III) neurotoxin family. ATX III is a neurotoxin that is produced by sea anemone; it adopts a compact structure containing four reverse turns and two other chain reversals, but no regular alpha-helix or beta-sheet. A hydrophobic patch found on the surface of the peptide may constitute part of the sodium channel binding surface [].; GO: 0019871 sodium channel inhibitor activity, 0009405 pathogenesis, 0042151 nematocyst; PDB: 1ANS_A.
Probab=20.78  E-value=45  Score=20.06  Aligned_cols=8  Identities=63%  Similarity=1.614  Sum_probs=3.6

Q ss_pred             CC-CCCCCC
Q 045506          160 CP-GQCAWP  167 (173)
Q Consensus       160 CP-G~CAwP  167 (173)
                      || |||++|
T Consensus        15 C~WGQ~~~~   23 (27)
T PF08098_consen   15 CPWGQNCYP   23 (27)
T ss_dssp             -SSS-SS-S
T ss_pred             Ccccccccc
Confidence            66 777776


No 15 
>PF14832 Tautomerase_3:  Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A.
Probab=20.76  E-value=1e+02  Score=24.53  Aligned_cols=26  Identities=23%  Similarity=0.512  Sum_probs=17.9

Q ss_pred             eEEEEE--eecCChhhHhHHHHHHHhcC
Q 045506           46 PVSILW--YGEFSPAQKSIIADFLLSLN   71 (173)
Q Consensus        46 ~V~lIw--YG~ftp~QksiI~DFl~SLs   71 (173)
                      +++.||  .|.||+.||+-+++=|..+-
T Consensus         2 Plw~I~h~~~~lt~~~K~~LA~~IT~~y   29 (136)
T PF14832_consen    2 PLWQIYHPPGTLTPEQKQALAEAITDIY   29 (136)
T ss_dssp             -EEEEEEETTSS-HHHHHHHHHHHHHHH
T ss_pred             CcEEEEeCCCCCCHHHHHHHHHHHHHHH
Confidence            566777  57899999997776666553


No 16 
>cd03062 TRX_Fd_Sucrase TRX-like [2Fe-2S] Ferredoxin (Fd) family, Sucrase subfamily; composed of proteins with similarity to a novel plant enzyme, isolated from potato, which contains a Fd-like domain and exhibits sucrolytic activity. The putative active site of the Fd-like domain of the enzyme contains two cysteines and two histidines for possible binding to iron-sulfur clusters, compared to four cysteines present in the active site of Fd.
Probab=20.22  E-value=86  Score=22.98  Aligned_cols=18  Identities=33%  Similarity=0.798  Sum_probs=13.4

Q ss_pred             EEEEeecCChhhHhHHHH
Q 045506           48 SILWYGEFSPAQKSIIAD   65 (173)
Q Consensus        48 ~lIwYG~ftp~QksiI~D   65 (173)
                      -=+|||+-+|..-.-|.+
T Consensus        63 ~g~wy~~v~p~~v~~Iv~   80 (97)
T cd03062          63 DGIWYGRVTPEHVPPIVD   80 (97)
T ss_pred             CeeEEeecCHHHHHHHHH
Confidence            349999999998654443


No 17 
>PF13873 Myb_DNA-bind_5:  Myb/SANT-like DNA-binding domain
Probab=20.19  E-value=85  Score=21.41  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=14.1

Q ss_pred             cCChhhHhHHHHHHHh
Q 045506           54 EFSPAQKSIIADFLLS   69 (173)
Q Consensus        54 ~ftp~QksiI~DFl~S   69 (173)
                      +||+.|+.++.+|+..
T Consensus         4 ~fs~~E~~~Lv~~v~~   19 (78)
T PF13873_consen    4 NFSEEEKEILVELVEK   19 (78)
T ss_pred             CCCHHHHHHHHHHHHH
Confidence            7999999999999754


No 18 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=20.02  E-value=28  Score=24.28  Aligned_cols=16  Identities=31%  Similarity=0.821  Sum_probs=13.6

Q ss_pred             CCCccccCCccccccc
Q 045506          123 GKILKKAQGFCMSNCG  138 (173)
Q Consensus       123 GKsL~~~~gFC~s~CG  138 (173)
                      |+.+..++.||++.|+
T Consensus        10 G~~Ip~~~~fCS~~C~   25 (59)
T PF09889_consen   10 GKPIPPDESFCSPKCR   25 (59)
T ss_pred             CCcCCcchhhhCHHHH
Confidence            7777777899999996


Done!