Query         045520
Match_columns 305
No_of_seqs    55 out of 57
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 02:56:55 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045520.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045520hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07039 DUF1325:  SGF29 tudor-  86.5     1.9 4.1E-05   36.8   5.7   37   63-104     1-37  (130)
  2 cd01735 LSm12_N LSm12 belongs   70.1     4.9 0.00011   30.9   2.9   20   85-104    17-36  (61)
  3 PF03088 Str_synth:  Strictosid  53.2      17 0.00037   29.4   3.3   19   87-105    35-53  (89)
  4 PF09465 LBR_tudor:  Lamin-B re  50.7      30 0.00065   26.5   4.1   27   79-105    15-41  (55)
  5 PF09816 EAF:  RNA polymerase I  34.6      39 0.00085   27.6   2.8   18   91-108    81-98  (109)
  6 PF07076 DUF1344:  Protein of u  30.4      49  0.0011   25.8   2.5   25   87-111     5-29  (61)
  7 PF09701 Cas_Cmr5:  CRISPR-asso  29.2      20 0.00043   29.7   0.2   18  287-304    39-56  (122)
  8 PF05257 CHAP:  CHAP domain;  I  28.8 1.2E+02  0.0027   24.2   4.8   39   58-104    59-98  (124)
  9 PF05652 DcpS:  Scavenger mRNA   28.5      86  0.0019   26.2   3.9   23   83-105     3-25  (110)
 10 PF14157 YmzC:  YmzC-like prote  27.8      67  0.0015   25.3   2.9   21   84-104    36-56  (63)
 11 TIGR03847 conserved hypothetic  25.1   1E+02  0.0022   28.5   4.0   26   81-106    83-109 (177)
 12 PF10030 DUF2272:  Uncharacteri  24.8      58  0.0013   29.7   2.4   20   51-70     83-102 (183)
 13 PF03843 Slp:  Outer membrane l  24.7 1.3E+02  0.0029   26.4   4.5   61   88-158    40-100 (160)
 14 TIGR02594 conserved hypothetic  24.0 1.7E+02  0.0037   24.8   4.9   34   61-104    73-106 (129)
 15 PF11290 DUF3090:  Protein of u  22.3      95  0.0021   28.5   3.2   23   84-106    84-107 (171)
 16 cd05687 S1_RPS1_repeat_ec1_hs1  20.1 1.9E+02  0.0042   20.6   3.9   16   61-76     44-59  (70)

No 1  
>PF07039 DUF1325:  SGF29 tudor-like domain;  InterPro: IPR010750  SAGA-associated factor 29 is involved in transcriptional regulation, probably through association with histone acetyltransferase (HAT) complexes like the TFTC-HAT or STAGA complexes. It also may be involved in MYC-mediated oncogenic transformation. It is a component of the ATAC complex, which is a complex with histone acetyltransferase activity on histones H3 and H4 [].   This entry represents a domain found in yeast and human SAGA-associated factor 29 proteins that is related to the tudor domain. ; PDB: 3MP6_A 3MP1_A 3MP8_A 3MET_B 3ME9_A 3MEU_B 3MEA_A 3MEV_B 3LX7_A 3MEW_A.
Probab=86.54  E-value=1.9  Score=36.83  Aligned_cols=37  Identities=22%  Similarity=0.355  Sum_probs=28.9

Q ss_pred             CCCCEEEEEEeeeCCCCCCCCCceeeeEEeeeeCCCCeEEEE
Q 045520           63 KEGDVIAYRLIELTSSWTPEPSSFRVGKISWYDSDTNKILLA  104 (305)
Q Consensus        63 qvGDvIAfKLLELS~nYTPEVSsYKeGKVv~yDp~tk~I~Le  104 (305)
                      |+||.+|||+-     ..-+=-+|..++|++|+..+++++++
T Consensus         1 q~G~~VAak~~-----~~~~~~~WIla~Vv~~~~~~~rYeV~   37 (130)
T PF07039_consen    1 QPGDQVAAKVK-----QGNEEEEWILAEVVKYNSDGNRYEVE   37 (130)
T ss_dssp             -TT-EEEEEEC-----TTTTTCEEEEEEEEEEETTTTEEEEE
T ss_pred             CCCCEEEEEcC-----CCCCCCCEEEEEEEEEeCCCCEEEEe
Confidence            68999999997     22222678999999999999888887


No 2  
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet that associates with other Sm proteins to form hexameric and heptameric ring structures.   In addition to the N-terminal Sm-like domain, LSm12 has a novel methyltransferase domain.
Probab=70.08  E-value=4.9  Score=30.90  Aligned_cols=20  Identities=15%  Similarity=0.283  Sum_probs=17.8

Q ss_pred             ceeeeEEeeeeCCCCeEEEE
Q 045520           85 SFRVGKISWYDSDTNKILLA  104 (305)
Q Consensus        85 sYKeGKVv~yDp~tk~I~Le  104 (305)
                      +--+|+|+.||..|+++.|+
T Consensus        17 ~~ieGEV~afD~~tk~lIlk   36 (61)
T cd01735          17 QRLQGEVVAFDYPSKMLILK   36 (61)
T ss_pred             ceEEEEEEEecCCCcEEEEE
Confidence            34689999999999999998


No 3  
>PF03088 Str_synth:  Strictosidine synthase;  InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4.3.3.2 from EC), a key enzyme in alkaloid biosynthesis. It catalyses the Pictet-Spengler stereospecific condensation of tryptamine with secologanin to form strictosidine []. The structure of the native enzyme from the Indian medicinal plant Rauvolfia serpentina (Serpentwood) (Devilpepper) represents the first example of a six-bladed four-stranded beta-propeller fold from the plant kingdom [].; GO: 0016844 strictosidine synthase activity, 0009058 biosynthetic process; PDB: 2FPB_A 2V91_B 2FP8_A 3V1S_B 2FPC_A 2VAQ_A 2FP9_B.
Probab=53.18  E-value=17  Score=29.41  Aligned_cols=19  Identities=21%  Similarity=0.384  Sum_probs=15.5

Q ss_pred             eeeEEeeeeCCCCeEEEEE
Q 045520           87 RVGKISWYDSDTNKILLAP  105 (305)
Q Consensus        87 KeGKVv~yDp~tk~I~Le~  105 (305)
                      .-|+++.|||.|+++++.+
T Consensus        35 ~~GRll~ydp~t~~~~vl~   53 (89)
T PF03088_consen   35 PTGRLLRYDPSTKETTVLL   53 (89)
T ss_dssp             --EEEEEEETTTTEEEEEE
T ss_pred             CCcCEEEEECCCCeEEEeh
Confidence            3699999999999988774


No 4  
>PF09465 LBR_tudor:  Lamin-B receptor of TUDOR domain;  InterPro: IPR019023  The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane. It is one of the integral inner nuclear envelope membrane proteins responsible for targeting nuclear membranes to chromatin, being a downstream effector of Ran, a small Ras-like nuclear GTPase which regulates NE assembly. Lamin-B receptor interacts with importin beta, a Ran-binding protein, thereby directly contributing to the fusion of membrane vesicles and the formation of the nuclear envelope []. ; PDB: 2L8D_A 2DIG_A.
Probab=50.69  E-value=30  Score=26.46  Aligned_cols=27  Identities=26%  Similarity=0.349  Sum_probs=22.2

Q ss_pred             CCCCCCceeeeEEeeeeCCCCeEEEEE
Q 045520           79 WTPEPSSFRVGKISWYDSDTNKILLAP  105 (305)
Q Consensus        79 YTPEVSsYKeGKVv~yDp~tk~I~Le~  105 (305)
                      +=|.=+.|=+|+|++||..++...++-
T Consensus        15 rWP~s~lYYe~kV~~~d~~~~~y~V~Y   41 (55)
T PF09465_consen   15 RWPGSSLYYEGKVLSYDSKSDRYTVLY   41 (55)
T ss_dssp             E-TTTS-EEEEEEEEEETTTTEEEEEE
T ss_pred             ECCCCCcEEEEEEEEecccCceEEEEE
Confidence            458889999999999999999998873


No 5  
>PF09816 EAF:  RNA polymerase II transcription elongation factor;  InterPro: IPR019194  This entry represents the N-terminal domain of ELL-associated factor (Eaf) proteins, which act as transcriptional transactivators of ELL and ELL2 RNA Polymerase II (Pol II) transcriptional elongation factors [, , , ]. Eaf proteins form a stable heterodimer complex with ELL proteins to facilitate the binding of RNA polymerase II to activate transcription elongation. ELL and EAF1 are components of Cajal bodies, which have a role in leukemogenesis []. EAF1 also has the capacity to interact with ELL1 and ELL2. The N terminus of approx 120 of EAF1 has a region of high serine, aspartic acid, and glutamic acid residues [, ].
Probab=34.60  E-value=39  Score=27.63  Aligned_cols=18  Identities=17%  Similarity=0.455  Sum_probs=16.2

Q ss_pred             EeeeeCCCCeEEEEEcCC
Q 045520           91 ISWYDSDTNKILLAPVPE  108 (305)
Q Consensus        91 Vv~yDp~tk~I~Le~v~~  108 (305)
                      |+.||+.++.++||+|..
T Consensus        81 VLifD~~~~~f~LErl~s   98 (109)
T PF09816_consen   81 VLIFDPETGEFVLERLSS   98 (109)
T ss_pred             EEEEECCCCEEEEEEcce
Confidence            677999999999999875


No 6  
>PF07076 DUF1344:  Protein of unknown function (DUF1344);  InterPro: IPR009780 This family consists of several short, hypothetical bacterial proteins of around 80 residues in length. Members of this family are found in Rhizobium, Agrobacterium and Brucella species. The function of this family is unknown.
Probab=30.35  E-value=49  Score=25.77  Aligned_cols=25  Identities=32%  Similarity=0.325  Sum_probs=20.0

Q ss_pred             eeeEEeeeeCCCCeEEEEEcCCCCC
Q 045520           87 RVGKISWYDSDTNKILLAPVPEYPL  111 (305)
Q Consensus        87 KeGKVv~yDp~tk~I~Le~v~~~P~  111 (305)
                      -+|+|.++|+.+..|+|.==..|.+
T Consensus         5 veG~I~~id~~~~titLdDGksy~l   29 (61)
T PF07076_consen    5 VEGTIKSIDPETMTITLDDGKSYKL   29 (61)
T ss_pred             ceEEEEEEcCCceEEEecCCCEEEC
Confidence            4899999999999999986444433


No 7  
>PF09701 Cas_Cmr5:  CRISPR-associated protein (Cas_Cmr5);  InterPro: IPR010160 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a family of Cas proteins as represented by TM1791.1 from Thermotoga maritima. This family of Cas proteins are found in both archaeal and bacterial species.; PDB: 2OEB_A 2ZOP_A.
Probab=29.18  E-value=20  Score=29.72  Aligned_cols=18  Identities=39%  Similarity=0.589  Sum_probs=14.7

Q ss_pred             hhccccchhHHhhhccCC
Q 045520          287 LRSSALGPTMAFLRSENG  304 (305)
Q Consensus       287 lR~sAlGPtma~LR~qn~  304 (305)
                      ++.+.||+|+|||.++.+
T Consensus        39 I~~nGL~qtlAF~~sK~~   56 (122)
T PF09701_consen   39 ILQNGLGQTLAFLLSKGK   56 (122)
T ss_dssp             HHHH-HHHHHHHHHCTSS
T ss_pred             HHHcCHHHHHHHHHhccc
Confidence            578999999999998764


No 8  
>PF05257 CHAP:  CHAP domain;  InterPro: IPR007921 The CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain is a region between 110 and 140 amino acids that is found in proteins from bacteria, bacteriophages, archaea and eukaryotes of the Trypanosomidae family. Many of these proteins are uncharacterised, but it has been proposed that they may function mainly in peptidoglycan hydrolysis. The CHAP domain is found in a wide range of protein architectures; it is commonly associated with bacterial type SH3 domains and with several families of amidase domains. It has been suggested that CHAP domain containing proteins utilise a catalytic cysteine residue in a nucleophilic-attack mechanism [, ]. The CHAP domain contains two invariant residues, a cysteine and a histidine. These residues form part of the putative active site of CHAP domain containing proteins. Secondary structure predictions show that the CHAP domain belongs to the alpha + beta structural class, with the N-terminal half largely containing predicted alpha helices and the C-terminal half principally composed of predicted beta strands [, ]. Some proteins known to contain a CHAP domain are listed below:   Bacterial and trypanosomal glutathionylspermidine amidases.  A variety of bacterial autolysins.  A Nocardia aerocolonigenes putative esterase.  Streptococcus pneumoniae choline-binding protein D.  Methanosarcina mazei protein MM2478, a putative chloride channel.  Several phage-encoded peptidoglycan hydrolases.  Cysteine peptidases belonging to MEROPS peptidase family C51 (D-alanyl-glycyl endopeptidase, clan CA).  ; PDB: 2LRJ_A 2VPM_B 2VOB_B 2VPS_A 2K3A_A 2IO9_A 2IO8_A 2IOB_A 2IOA_B 2IO7_B ....
Probab=28.83  E-value=1.2e+02  Score=24.23  Aligned_cols=39  Identities=15%  Similarity=0.288  Sum_probs=21.3

Q ss_pred             CCCCCCCCCEEEEEEeeeCCCCCCCCCce-eeeEEeeeeCCCCeEEEE
Q 045520           58 YISLPKEGDVIAYRLIELTSSWTPEPSSF-RVGKISWYDSDTNKILLA  104 (305)
Q Consensus        58 La~~PqvGDvIAfKLLELS~nYTPEVSsY-KeGKVv~yDp~tk~I~Le  104 (305)
                      ....||+||+|.|+     ...   -..| -+|-|...........+|
T Consensus        59 ~~~~P~~Gdivv~~-----~~~---~~~~GHVaIV~~v~~~~~i~v~e   98 (124)
T PF05257_consen   59 TGSTPQPGDIVVWD-----SGS---GGGYGHVAIVESVNDGGTITVIE   98 (124)
T ss_dssp             ECS---TTEEEEEE-----ECT---TTTT-EEEEEEEE-TTSEEEEEE
T ss_pred             cCcccccceEEEec-----cCC---CCCCCeEEEEEEECCCCEEEEEE
Confidence            45679999999998     111   1112 678888774444555554


No 9  
>PF05652 DcpS:  Scavenger mRNA decapping enzyme (DcpS) N-terminal;  InterPro: IPR008594 This entry represents scavenger mRNA decapping enzymes, such as Dcp2 and DcpS. DcpS is a scavenger pyrophosphatase that hydrolyses the residual cap structure following 3' to 5' mRNA degradation. DcpS uses cap dinucleotides or capped oligonucleotides as substrate to release m(7)GMP (N7-methyl GMP), while Dcp2 uses capped mRNA as substrate in order to hydrolyse the cap to release m(7)GDP (N7-methyl GDP) []. The association of DcpS with 3' to 5' exonuclease exosome components suggests that these two activities are linked and there is a coupled exonucleolytic decay-dependent decapping pathway. The family contains a histidine triad (HIT) sequence with three histidines separated by hydrophobic residues []. The central histidine within the DcpS HIT motif is critical for decapping activity and defines the HIT motif as a new mRNA decapping domain, making DcpS the first member of the HIT family of proteins with a defined biological function. This family is related to IPR001310 from INTERPRO  More information about these proteins can be found at Protein of the Month: RNA Exosomes [].; GO: 0016787 hydrolase activity, 0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B.
Probab=28.48  E-value=86  Score=26.18  Aligned_cols=23  Identities=26%  Similarity=0.281  Sum_probs=20.3

Q ss_pred             CCceeeeEEeeeeCCCCeEEEEE
Q 045520           83 PSSFRVGKISWYDSDTNKILLAP  105 (305)
Q Consensus        83 VSsYKeGKVv~yDp~tk~I~Le~  105 (305)
                      |+.|+.-||+.-|+.++.|.|.=
T Consensus         3 l~~F~~~rvL~~d~~~K~i~llG   25 (110)
T PF05652_consen    3 LSDFKFERVLNEDPQTKSISLLG   25 (110)
T ss_dssp             SS-EEEEEEEEEETTTTEEEEEE
T ss_pred             ccccEEEEecCCCCCCCeEEEEe
Confidence            78999999999999999999873


No 10 
>PF14157 YmzC:  YmzC-like protein; PDB: 3KVP_E.
Probab=27.84  E-value=67  Score=25.31  Aligned_cols=21  Identities=43%  Similarity=0.340  Sum_probs=17.1

Q ss_pred             CceeeeEEeeeeCCCCeEEEE
Q 045520           84 SSFRVGKISWYDSDTNKILLA  104 (305)
Q Consensus        84 SsYKeGKVv~yDp~tk~I~Le  104 (305)
                      .+...=||..||+.++.|+|.
T Consensus        36 ~e~~~iKIfkyd~~tNei~L~   56 (63)
T PF14157_consen   36 DEDGQIKIFKYDEDTNEITLK   56 (63)
T ss_dssp             -ETTEEEEEEEETTTTEEEEE
T ss_pred             ecCCeEEEEEeCCCCCeEEEE
Confidence            445567999999999999985


No 11 
>TIGR03847 conserved hypothetical protein. The conserved hypothetical protein described here occurs as part of the trio of uncharacterized proteins common in the Actinobacteria.
Probab=25.09  E-value=1e+02  Score=28.50  Aligned_cols=26  Identities=27%  Similarity=0.626  Sum_probs=21.1

Q ss_pred             CCCCceeeeEE-eeeeCCCCeEEEEEc
Q 045520           81 PEPSSFRVGKI-SWYDSDTNKILLAPV  106 (305)
Q Consensus        81 PEVSsYKeGKV-v~yDp~tk~I~Le~v  106 (305)
                      |=--+||+|.+ ++||+.+.+|.||..
T Consensus        83 PveeeFrvGtm~LgwD~e~~~vviEa~  109 (177)
T TIGR03847        83 PIEEEFRVGTMGLGWDPETDRVVIEAQ  109 (177)
T ss_pred             CcchhheeeeeEEeEcCCCCEEEEEEe
Confidence            33457899998 689999999999854


No 12 
>PF10030 DUF2272:  Uncharacterized protein conserved in bacteria (DUF2272);  InterPro: IPR019262 This is a domain of unknown function found in proteins of unknown function.
Probab=24.80  E-value=58  Score=29.68  Aligned_cols=20  Identities=35%  Similarity=0.625  Sum_probs=14.8

Q ss_pred             cccCCCCCCCCCCCCCEEEE
Q 045520           51 EFEKLPPYISLPKEGDVIAY   70 (305)
Q Consensus        51 Dye~LP~La~~PqvGDvIAf   70 (305)
                      .|-...+-...|++||+|+|
T Consensus        83 ~~~~~~~~~y~P~~GDlIc~  102 (183)
T PF10030_consen   83 PFRARDPAEYKPRPGDLICY  102 (183)
T ss_pred             cccccCcCCCCCCCCCEEEe
Confidence            44444555668999999998


No 13 
>PF03843 Slp:  Outer membrane lipoprotein Slp family;  InterPro: IPR004658 Slp superfamily members are present in the Gram-negative gamma proteobacteria Escherichia coli (which also contains a close paralog), Haemophilus influenzae and Pasteurella multocida and Vibrio cholerae. The known members of the family to date share a motif LX[GA]C near the N terminus, which is compatible with the possibility that the protein is modified into a lipoprotein with Cys as the new N terminus. Slp from E. coli is known to be a lipoprotein of the outer membrane and to be expressed in response to carbon starvation.; GO: 0019867 outer membrane
Probab=24.67  E-value=1.3e+02  Score=26.44  Aligned_cols=61  Identities=21%  Similarity=0.174  Sum_probs=43.8

Q ss_pred             eeEEeeeeCCCCeEEEEEcCCCCCccccCCchhhhccCCCcccCCCCcEEEEeccccceeeeecCCCcccc
Q 045520           88 VGKISWYDSDTNKILLAPVPEYPLAFEKKTDENVSALQSETLYGEDGSLRIDFSLLLDVRIIKHGEKANEV  158 (305)
Q Consensus        88 eGKVv~yDp~tk~I~Le~v~~~P~~~e~pg~ed~s~~kfDlvYqeDGsl~VeyssLiDpRLI~~~~s~~~~  158 (305)
                      =|+|+......++-+||+ -.+|+...  +       +++.--+..|-+.+.+.-++||=+...+...+..
T Consensus        40 GG~I~~v~n~~~~T~leV-~~~PLd~~--g-------rP~~~~~s~GRFla~~~gFLDP~~y~~Gr~vTV~  100 (160)
T PF03843_consen   40 GGVIVNVRNLPDQTELEV-VQYPLDSS--G-------RPQTDDPSQGRFLARVPGFLDPAIYAPGRLVTVV  100 (160)
T ss_pred             CCEEEEEEECCCceEEEE-EEccCCCC--C-------CcCCCCCCCCEEEEEeCCCcCHHHcCCCCEEEEE
Confidence            378888888888888884 45666432  3       5555544669999999999999888766655444


No 14 
>TIGR02594 conserved hypothetical protein TIGR02594. Members of this protein family known so far are restricted to the bacteria, and for the most to the proteobacteria. The function is unknown.
Probab=24.00  E-value=1.7e+02  Score=24.81  Aligned_cols=34  Identities=24%  Similarity=0.222  Sum_probs=24.8

Q ss_pred             CCCCCCEEEEEEeeeCCCCCCCCCceeeeEEeeeeCCCCeEEEE
Q 045520           61 LPKEGDVIAYRLIELTSSWTPEPSSFRVGKISWYDSDTNKILLA  104 (305)
Q Consensus        61 ~PqvGDvIAfKLLELS~nYTPEVSsYKeGKVv~yDp~tk~I~Le  104 (305)
                      .||+||+|-|+.   +       +..-+|=++..|.+.++|.+.
T Consensus        73 ~p~~GDiv~f~~---~-------~~~HVGi~~g~~~~~g~i~~l  106 (129)
T TIGR02594        73 KPAYGCIAVKRR---G-------GGGHVGFVVGKDKQTGTIIVL  106 (129)
T ss_pred             CCCccEEEEEEC---C-------CCCEEEEEEeEcCCCCEEEEe
Confidence            689999999962   1       134789999888765666554


No 15 
>PF11290 DUF3090:  Protein of unknown function (DUF3090);  InterPro: IPR021441  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=22.32  E-value=95  Score=28.48  Aligned_cols=23  Identities=26%  Similarity=0.608  Sum_probs=20.0

Q ss_pred             CceeeeEE-eeeeCCCCeEEEEEc
Q 045520           84 SSFRVGKI-SWYDSDTNKILLAPV  106 (305)
Q Consensus        84 SsYKeGKV-v~yDp~tk~I~Le~v  106 (305)
                      -+||+|.+ ++||+.+.+|.|+..
T Consensus        84 ~eFRVGtM~LgwD~~~~~vviea~  107 (171)
T PF11290_consen   84 EEFRVGTMGLGWDPETARVVIEAQ  107 (171)
T ss_pred             hheeeeeEEeeEcCCCCEEEEEee
Confidence            46899997 799999999999973


No 16 
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 1 of the Escherichia coli and Homo sapiens RPS1 (ec1 and hs1, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=20.15  E-value=1.9e+02  Score=20.64  Aligned_cols=16  Identities=19%  Similarity=0.272  Sum_probs=11.8

Q ss_pred             CCCCCCEEEEEEeeeC
Q 045520           61 LPKEGDVIAYRLIELT   76 (305)
Q Consensus        61 ~PqvGDvIAfKLLELS   76 (305)
                      ..++||+|-++++++.
T Consensus        44 ~~~~Gd~i~~~i~~~~   59 (70)
T cd05687          44 EVKVGDEVEVYVLRVE   59 (70)
T ss_pred             cCCCCCEEEEEEEEEE
Confidence            3688999888766654


Done!