Citrus Sinensis ID: 045530

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MVILVMATSVQSQGGLKAGFYSSSCPGAEAIVRSTVESHFKKDPTVAAGLLRLHFHDCFVQGCDGSVLIAGSSAERSALPNLGLRGFEVIDDAKTQLEASCPGVVSCADILALAARDSVDLSDGPSWQVPTGRRDGRVSSSQGLNLPSPLDSVTVQRQKFAAKGLDDHDLVTLVGAHTIGQTDCQFFRYRLYNFTTTGNADPSISQSFLAQLQTLCPKDGDGTKRVALDIDSQNKFDVSFFKNVRDGKGVLESDQRLWEDAATRNIVQNYAGTIRGLLGFRFDFEFPKAMIKMSSIEVKTGSDGEIRKICSKFN
cEEEEEHHcccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHccccccccccccccHHHHccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccc
MVILVMATSVQSQGGLKAGFYSSSCPGAEAIVRSTVESHFKKDPTVAAGLLRLHFHDCFVQGCDGSVLIAGSSAERSALPNLGLRGFEVIDDAKTQLEASCPGVVSCADILALAARDSVDLSDGPSWQVPTGRRDGRVSSSQGLNLPSPLDSVTVQRQKFAAKGLDDHDLVTLVGAHTIGQTDCQFFRYRLYNFTTTGNADPSISQSFLAQLQTLCPKDGDGTKRVALDIDSQNKFDVSFFKNVRDGKGVLESDQRLWEDAATRNIVQNYAGTIRGLLGFRFDFEFPKAMIKMSSIEVKTGSDGEIRKICSKFN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVILVMATSVQSQGGLKAGFYSSSCPGAEAIVRSTVESHFKKDPTVAAGLLRLHFHDCFVQGCDGSVLIAGSSAERSALPNLGLRGFEVIDDAKTQLEASCPGVVSCADILALAARDSVDLSDGPSWQVPTGRRDGRVSSSQGLNLPSPLDSVTVQRQKFAAKGLDDHDLVTLVGAHTIGQTDCQFFRYRLYNFTTTGNADPSISQSFLAQLQTLCPKDGDGTKRVALDIDSQNKFDVSFFKNVRDGKGVLESDQRLWEDAATRNIVQNYAGTIRGLLGFRFDFEFPKAMIKMSSIEVKTGSDGEIRKICSKFN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxidase 25 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.confidentO80822
Cationic peroxidase 2 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.probableP22196
Peroxidase N1 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue. Can use NADH, NADPH and monolignols as substrates.probableQ9XIV8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.11.-.-Acting on a peroxide as acceptor.probable
1.11.1.-Peroxidases.probable
1.11.1.7Peroxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PA2, chain A
Confidence level:very confident
Coverage over the Query: 15-314
View the alignment between query and template
View the model in PyMOL