Query         045532
Match_columns 173
No_of_seqs    117 out of 132
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 03:02:27 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045532.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045532hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00397 WW:  WW domain;  Inter  96.8  0.0008 1.7E-08   40.7   2.0   29   32-63      1-30  (31)
  2 smart00456 WW Domain with 2 co  95.9   0.007 1.5E-07   35.8   2.5   29   32-64      1-30  (32)
  3 cd00201 WW Two conserved trypt  95.1   0.022 4.8E-07   33.1   2.4   28   33-64      1-29  (31)
  4 PRK08351 DNA-directed RNA poly  87.9    0.24 5.2E-06   35.1   0.9   25  123-151     1-25  (61)
  5 PRK06393 rpoE DNA-directed RNA  81.1    0.59 1.3E-05   33.5   0.4   24  124-151     4-27  (64)
  6 KOG3259 Peptidyl-prolyl cis-tr  79.4     1.3 2.8E-05   36.9   1.9   34   29-65      4-38  (163)
  7 PRK00398 rpoP DNA-directed RNA  79.2     1.8 3.9E-05   27.9   2.2   31  123-153     1-33  (46)
  8 PF12172 DUF35_N:  Rubredoxin-l  64.7       5 0.00011   24.6   1.7   29  120-150     6-34  (37)
  9 TIGR02098 MJ0042_CXXC MJ0042 f  64.5     4.6  0.0001   24.7   1.5   26  126-151     3-35  (38)
 10 PF09538 FYDLN_acid:  Protein o  59.0     5.7 0.00012   30.7   1.4   27  127-154    11-39  (108)
 11 COG3357 Predicted transcriptio  57.7     4.2 9.1E-05   31.4   0.5   32  120-151    53-86  (97)
 12 smart00391 MBD Methyl-CpG bind  57.0     8.5 0.00019   27.8   2.0   17   28-47      4-20  (77)
 13 PF14369 zf-RING_3:  zinc-finge  52.9      14  0.0003   23.2   2.2   23  128-150     5-30  (35)
 14 smart00659 RPOLCX RNA polymera  52.8      11 0.00023   24.8   1.7   28  126-153     3-31  (44)
 15 PF11023 DUF2614:  Protein of u  51.7     6.7 0.00015   31.1   0.8   32  124-156    68-100 (114)
 16 PF07295 DUF1451:  Protein of u  51.7      17 0.00037   29.4   3.1   33  119-151   106-140 (146)
 17 cd00122 MBD MeCP2, MBD1, MBD2,  49.9      15 0.00034   25.0   2.3   17   28-47      2-18  (62)
 18 TIGR00155 pqiA_fam integral me  49.7     8.4 0.00018   35.5   1.2   26  125-151   215-240 (403)
 19 PF10164 DUF2367:  Uncharacteri  49.4      19  0.0004   28.0   2.9   18  119-136    43-60  (98)
 20 TIGR00100 hypA hydrogenase nic  49.1      15 0.00032   28.2   2.3   28  124-151    69-96  (115)
 21 COG1096 Predicted RNA-binding   47.5      12 0.00025   32.0   1.6   32  119-150   143-174 (188)
 22 PRK12380 hydrogenase nickel in  47.4      16 0.00035   27.9   2.3   27  124-150    69-95  (113)
 23 PRK03681 hypA hydrogenase nick  45.9      17 0.00036   27.9   2.1   28  124-151    69-97  (114)
 24 PF13248 zf-ribbon_3:  zinc-rib  43.1      11 0.00024   21.8   0.6   22  127-150     4-25  (26)
 25 PF13719 zinc_ribbon_5:  zinc-r  43.0      11 0.00024   23.5   0.7   26  125-150     2-34  (37)
 26 COG5104 PRP40 Splicing factor   43.0     6.4 0.00014   38.1  -0.7   28   34-65     15-43  (590)
 27 COG1867 TRM1 N2,N2-dimethylgua  42.9      14 0.00031   34.5   1.6   31  121-151   236-267 (380)
 28 cd01397 HAT_MBD Methyl-CpG bin  42.4      23 0.00051   25.8   2.3   28   28-58      2-36  (73)
 29 cd04482 RPA2_OBF_like RPA2_OBF  42.1      13 0.00028   27.2   1.0   10  139-148    82-91  (91)
 30 PRK00420 hypothetical protein;  42.1      14  0.0003   29.0   1.2   34  120-153    18-52  (112)
 31 PF08274 PhnA_Zn_Ribbon:  PhnA   41.2      11 0.00023   23.2   0.4   12  141-152     2-13  (30)
 32 cd00350 rubredoxin_like Rubred  40.9      21 0.00046   21.6   1.6   23  128-150     4-26  (33)
 33 PF10571 UPF0547:  Uncharacteri  39.9      13 0.00029   22.0   0.6   20  128-149     3-22  (26)
 34 PF01155 HypA:  Hydrogenase exp  39.5      12 0.00025   28.5   0.4   29  123-151    68-96  (113)
 35 PF14205 Cys_rich_KTR:  Cystein  37.2      18 0.00038   25.5   1.0   16  142-157    29-44  (55)
 36 TIGR00373 conserved hypothetic  36.9      14  0.0003   29.8   0.5   28  124-151   108-138 (158)
 37 PRK15103 paraquat-inducible me  36.6      17 0.00037   33.7   1.1   25  125-151   221-245 (419)
 38 cd07973 Spt4 Transcription elo  36.3      18 0.00039   27.6   1.0   23  126-148     4-27  (98)
 39 PRK03824 hypA hydrogenase nick  34.7      38 0.00083   26.6   2.7   27  124-150    69-116 (135)
 40 PRK06266 transcription initiat  33.6      19 0.00042   29.6   0.8   28  124-151   116-146 (178)
 41 TIGR02300 FYDLN_acid conserved  33.3      26 0.00056   28.3   1.5   30  127-156    11-41  (129)
 42 PRK11032 hypothetical protein;  33.1      54  0.0012   27.1   3.4   37  119-158   118-156 (160)
 43 COG1675 TFA1 Transcription ini  32.6      12 0.00025   31.4  -0.6   27  125-151   113-142 (176)
 44 PF04074 DUF386:  Domain of unk  32.6      18 0.00039   28.3   0.5   16   35-50     62-80  (153)
 45 PRK00564 hypA hydrogenase nick  31.2      27 0.00059   26.8   1.3   28  124-151    70-98  (117)
 46 PF14169 YdjO:  Cold-inducible   30.2      29 0.00063   24.5   1.2   15  137-151    35-49  (59)
 47 PF06582 DUF1136:  Repeat of un  30.0      15 0.00032   22.3  -0.3   15   27-41      2-16  (28)
 48 PF03811 Zn_Tnp_IS1:  InsA N-te  29.8      35 0.00075   21.6   1.4   14  138-151     2-15  (36)
 49 PF01429 MBD:  Methyl-CpG bindi  28.8      39 0.00084   24.0   1.6   10   28-37      7-16  (77)
 50 PRK12496 hypothetical protein;  28.3      31 0.00067   28.0   1.2   26  126-151   128-153 (164)
 51 PRK10202 ebgC cryptic beta-D-g  28.3      26 0.00056   28.0   0.7   20   33-52     56-78  (149)
 52 COG0375 HybF Zn finger protein  27.6      28 0.00061   27.4   0.8   28  124-151    69-96  (115)
 53 TIGR00155 pqiA_fam integral me  27.2      43 0.00093   30.9   2.0   27  125-151    13-43  (403)
 54 COG2995 PqiA Uncharacterized p  27.2      27 0.00059   33.1   0.8   27  124-151   219-245 (418)
 55 COG4416 Com Mu-like prophage p  27.1      26 0.00056   24.9   0.5   11  141-151    24-34  (60)
 56 COG2093 DNA-directed RNA polym  26.1      21 0.00046   25.8  -0.1   26  123-150     2-27  (64)
 57 TIGR00022 uncharacterized prot  25.9      28 0.00061   27.2   0.5   20   35-54     62-84  (142)
 58 PF03682 UPF0158:  Uncharacteri  25.8      42 0.00091   27.3   1.6   13   40-52     23-35  (163)
 59 PRK13130 H/ACA RNA-protein com  25.6      49  0.0011   23.0   1.6   24  124-151     4-27  (56)
 60 COG1998 RPS31 Ribosomal protei  24.6      42 0.00092   23.3   1.1   13  139-151    17-29  (51)
 61 PRK15103 paraquat-inducible me  24.6      53  0.0012   30.5   2.1   26  126-151    11-40  (419)
 62 COG2260 Predicted Zn-ribbon RN  24.5      56  0.0012   23.3   1.8   25  125-153     5-29  (59)
 63 PF10122 Mu-like_Com:  Mu-like   24.1      50  0.0011   22.9   1.4   31  127-157     6-40  (51)
 64 PF03604 DNA_RNApol_7kD:  DNA d  23.9      36 0.00079   21.1   0.7   25  128-152     3-28  (32)
 65 TIGR02605 CxxC_CxxC_SSSS putat  23.8      70  0.0015   20.5   2.0   27  124-150     4-35  (52)
 66 PF09723 Zn-ribbon_8:  Zinc rib  23.6      96  0.0021   19.6   2.6   25  125-149     5-34  (42)
 67 PF08271 TF_Zn_Ribbon:  TFIIB z  22.9      53  0.0012   20.7   1.3    9  143-151     2-10  (43)
 68 KOG3352 Cytochrome c oxidase,   22.5 1.5E+02  0.0032   24.8   4.1   36  123-159   109-151 (153)
 69 PRK02935 hypothetical protein;  22.1      57  0.0012   25.8   1.6   37  121-158    66-103 (110)
 70 smart00834 CxxC_CXXC_SSSS Puta  21.8 1.6E+02  0.0034   17.6   3.3   28  123-150     3-35  (41)
 71 COG1592 Rubrerythrin [Energy p  21.7      52  0.0011   27.4   1.3   25  125-150   134-158 (166)
 72 cd04476 RPA1_DBD_C RPA1_DBD_C:  21.5      62  0.0013   25.3   1.7   30  122-151    31-61  (166)
 73 cd00729 rubredoxin_SM Rubredox  21.5      84  0.0018   19.3   2.0   23  127-150     4-27  (34)
 74 TIGR00375 conserved hypothetic  21.1      33 0.00071   31.7   0.1   28  123-151   238-268 (374)
 75 COG5242 TFB4 RNA polymerase II  20.9      69  0.0015   28.8   2.0   27  123-151   258-284 (296)
 76 TIGR00627 tfb4 transcription f  20.6      43 0.00093   29.7   0.7   28  121-150   251-278 (279)
 77 COG1579 Zn-ribbon protein, pos  20.5      30 0.00064   30.3  -0.3   30  123-152   195-232 (239)
 78 COG1379 PHP family phosphoeste  20.3      22 0.00049   33.3  -1.2   29  123-151   244-275 (403)

No 1  
>PF00397 WW:  WW domain;  InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet. This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A ....
Probab=96.83  E-value=0.0008  Score=40.71  Aligned_cols=29  Identities=14%  Similarity=0.136  Sum_probs=23.4

Q ss_pred             CCcchhccceeeeeccccE-EEeeccCcccCCC
Q 045532           32 HPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRN   63 (173)
Q Consensus        32 lP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~   63 (173)
                      ||.+|+   .+.|-.+|++ |+|..|.+.+|..
T Consensus         1 LP~gW~---~~~~~~~g~~YY~N~~t~~s~W~~   30 (31)
T PF00397_consen    1 LPPGWE---EYFDPDSGRPYYYNHETGESQWER   30 (31)
T ss_dssp             SSTTEE---EEEETTTSEEEEEETTTTEEESSS
T ss_pred             CCcCCE---EEEcCCCCCEEEEeCCCCCEEeCC
Confidence            789996   8888668999 7799998766643


No 2  
>smart00456 WW Domain with 2 conserved Trp (W) residues. Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides.
Probab=95.95  E-value=0.007  Score=35.84  Aligned_cols=29  Identities=14%  Similarity=-0.060  Sum_probs=23.5

Q ss_pred             CCcchhccceeeeeccccE-EEeeccCcccCCCC
Q 045532           32 HPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRNG   64 (173)
Q Consensus        32 lP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~   64 (173)
                      ||.+|+   ++.|-. |++ |+|..|...+|..|
T Consensus         1 lp~gW~---~~~~~~-g~~yy~n~~t~~s~W~~P   30 (32)
T smart00456        1 LPPGWE---ERKDPD-GRPYYYNHETKETQWEKP   30 (32)
T ss_pred             CCCCCE---EEECCC-CCEEEEECCCCCEEcCCC
Confidence            689997   888988 999 77999877666554


No 3  
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs.
Probab=95.06  E-value=0.022  Score=33.06  Aligned_cols=28  Identities=14%  Similarity=0.127  Sum_probs=22.3

Q ss_pred             CcchhccceeeeeccccE-EEeeccCcccCCCC
Q 045532           33 PRLAKALFSFYLKAGGGI-YRCVHTAKMSRRNG   64 (173)
Q Consensus        33 P~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~   64 (173)
                      |.+|+   .+.|.. |++ |+|..|.+.+|..|
T Consensus         1 p~~W~---~~~~~~-g~~yy~n~~t~~s~W~~P   29 (31)
T cd00201           1 PPGWE---ERWDPD-GRVYYYNHNTKETQWEDP   29 (31)
T ss_pred             CCCCE---EEECCC-CCEEEEECCCCCEeCCCC
Confidence            67897   888988 999 77998877666544


No 4  
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=87.86  E-value=0.24  Score=35.13  Aligned_cols=25  Identities=28%  Similarity=0.691  Sum_probs=19.6

Q ss_pred             eEEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          123 MVLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       123 mV~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      |..-+|.+|+..+    ....||+|.+.-
T Consensus         1 M~~kAC~~C~~i~----~~~~CP~Cgs~~   25 (61)
T PRK08351          1 MTEKACRHCHYIT----TEDRCPVCGSRD   25 (61)
T ss_pred             CchhhhhhCCccc----CCCcCCCCcCCc
Confidence            4455899999877    455899999875


No 5  
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=81.08  E-value=0.59  Score=33.53  Aligned_cols=24  Identities=17%  Similarity=0.466  Sum_probs=19.7

Q ss_pred             EEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      .+.+|.+|+..+    .+..||.|++.-
T Consensus         4 ~~~AC~~C~~i~----~~~~Cp~Cgs~~   27 (64)
T PRK06393          4 QYRACKKCKRLT----PEKTCPVHGDEK   27 (64)
T ss_pred             hhhhHhhCCccc----CCCcCCCCCCCc
Confidence            456899999877    466999999875


No 6  
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=79.41  E-value=1.3  Score=36.91  Aligned_cols=34  Identities=12%  Similarity=-0.011  Sum_probs=27.1

Q ss_pred             CCCCCcchhccceeeeeccccE-EEeeccCcccCCCCC
Q 045532           29 PFPHPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRNGN   65 (173)
Q Consensus        29 ~~plP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~~   65 (173)
                      +..||.+||   ++.+--+|+. |+|+-|...-|..|.
T Consensus         4 ~~~LP~~We---kr~Srs~gr~YyfN~~T~~SqWe~P~   38 (163)
T KOG3259|consen    4 EEKLPPGWE---KRMSRSSGRPYYFNTETNESQWERPS   38 (163)
T ss_pred             cccCCchhh---eeccccCCCcceeccccchhhccCCC
Confidence            457999999   8889999999 779998765565543


No 7  
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=79.24  E-value=1.8  Score=27.88  Aligned_cols=31  Identities=35%  Similarity=0.653  Sum_probs=23.4

Q ss_pred             eEEeeCccceEEEEeeCC--CCCCCCCCCccee
Q 045532          123 MVLVGCPRCLMYVMLSED--DPKCPKCKSTVLL  153 (173)
Q Consensus       123 mV~~gC~~ClmYVMl~k~--~P~CP~Cks~vll  153 (173)
                      |+..-|+.|.--+-+...  ..+||.|.+.+.+
T Consensus         1 ~~~y~C~~CG~~~~~~~~~~~~~Cp~CG~~~~~   33 (46)
T PRK00398          1 MAEYKCARCGREVELDEYGTGVRCPYCGYRILF   33 (46)
T ss_pred             CCEEECCCCCCEEEECCCCCceECCCCCCeEEE
Confidence            567789999986555443  5899999988743


No 8  
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=64.66  E-value=5  Score=24.65  Aligned_cols=29  Identities=24%  Similarity=0.550  Sum_probs=18.6

Q ss_pred             CcceEEeeCccceEEEEeeCCCCCCCCCCCc
Q 045532          120 ATSMVLVGCPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       120 ~~~mV~~gC~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      ...+++.-|..|-.+++-++  +.||+|.+.
T Consensus         6 ~~~l~~~rC~~Cg~~~~pPr--~~Cp~C~s~   34 (37)
T PF12172_consen    6 EGRLLGQRCRDCGRVQFPPR--PVCPHCGSD   34 (37)
T ss_dssp             TT-EEEEE-TTT--EEES----SEETTTT--
T ss_pred             CCEEEEEEcCCCCCEecCCC--cCCCCcCcc
Confidence            35688999999999999887  899999865


No 9  
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=64.53  E-value=4.6  Score=24.69  Aligned_cols=26  Identities=23%  Similarity=0.678  Sum_probs=19.8

Q ss_pred             eeCccceEEEEeeCC-------CCCCCCCCCcc
Q 045532          126 VGCPRCLMYVMLSED-------DPKCPKCKSTV  151 (173)
Q Consensus       126 ~gC~~ClmYVMl~k~-------~P~CP~Cks~v  151 (173)
                      +-||+|.--+.+...       ..+||+|+..+
T Consensus         3 ~~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLGANGGKVRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHcCCCCCEEECCCCCCEE
Confidence            679999997777732       25899999764


No 10 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=58.97  E-value=5.7  Score=30.70  Aligned_cols=27  Identities=37%  Similarity=0.910  Sum_probs=20.0

Q ss_pred             eCccceE-EEEeeCCCCC-CCCCCCcceec
Q 045532          127 GCPRCLM-YVMLSEDDPK-CPKCKSTVLLD  154 (173)
Q Consensus       127 gC~~Clm-YVMl~k~~P~-CP~Cks~vll~  154 (173)
                      .|+.|-. |.=|.| +|. ||+|...+.+.
T Consensus        11 ~Cp~CG~kFYDLnk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDLNK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccCCC-CCccCCCCCCccCcc
Confidence            5899977 333566 665 99999988776


No 11 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=57.71  E-value=4.2  Score=31.41  Aligned_cols=32  Identities=25%  Similarity=0.463  Sum_probs=22.6

Q ss_pred             CcceEEeeCccceEEEEeeCCC--CCCCCCCCcc
Q 045532          120 ATSMVLVGCPRCLMYVMLSEDD--PKCPKCKSTV  151 (173)
Q Consensus       120 ~~~mV~~gC~~ClmYVMl~k~~--P~CP~Cks~v  151 (173)
                      .=.|+-+.|..|-+-+-=-+..  -+||+|||.-
T Consensus        53 ~Llv~Pa~CkkCGfef~~~~ik~pSRCP~CKSE~   86 (97)
T COG3357          53 RLLVRPARCKKCGFEFRDDKIKKPSRCPKCKSEW   86 (97)
T ss_pred             eEEecChhhcccCccccccccCCcccCCcchhhc
Confidence            3456668899998755543444  5999999873


No 12 
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=57.01  E-value=8.5  Score=27.80  Aligned_cols=17  Identities=18%  Similarity=0.053  Sum_probs=12.1

Q ss_pred             CCCCCCcchhccceeeeecc
Q 045532           28 LPFPHPRLAKALFSFYLKAG   47 (173)
Q Consensus        28 l~~plP~~WE~~~q~LDlqS   47 (173)
                      +++|||.||+   |.+-+..
T Consensus         4 ~~~Plp~GW~---R~~~~r~   20 (77)
T smart00391        4 LRLPLPCGWR---RETKQRK   20 (77)
T ss_pred             ccCCCCCCcE---EEEEEec
Confidence            6789999995   6655443


No 13 
>PF14369 zf-RING_3:  zinc-finger
Probab=52.87  E-value=14  Score=23.15  Aligned_cols=23  Identities=30%  Similarity=0.940  Sum_probs=15.8

Q ss_pred             CccceEEEEee--CCCCC-CCCCCCc
Q 045532          128 CPRCLMYVMLS--EDDPK-CPKCKST  150 (173)
Q Consensus       128 C~~ClmYVMl~--k~~P~-CP~Cks~  150 (173)
                      |-.|-..|=+.  ..+.. ||.|.+.
T Consensus         5 Ch~C~~~V~~~~~~~~~~~CP~C~~g   30 (35)
T PF14369_consen    5 CHQCNRFVRIAPSPDSDVACPRCHGG   30 (35)
T ss_pred             CccCCCEeEeCcCCCCCcCCcCCCCc
Confidence            66677777764  34444 9999976


No 14 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=52.81  E-value=11  Score=24.82  Aligned_cols=28  Identities=21%  Similarity=0.432  Sum_probs=21.5

Q ss_pred             eeCccceEEEEeeC-CCCCCCCCCCccee
Q 045532          126 VGCPRCLMYVMLSE-DDPKCPKCKSTVLL  153 (173)
Q Consensus       126 ~gC~~ClmYVMl~k-~~P~CP~Cks~vll  153 (173)
                      --|..|..-|-+.. ..-+||.|...++.
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~rIly   31 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGYRILY   31 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCceEEE
Confidence            45889998777664 44799999998864


No 15 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=51.70  E-value=6.7  Score=31.09  Aligned_cols=32  Identities=41%  Similarity=0.671  Sum_probs=26.3

Q ss_pred             EEeeCccceE-EEEeeCCCCCCCCCCCcceeccc
Q 045532          124 VLVGCPRCLM-YVMLSEDDPKCPKCKSTVLLDFL  156 (173)
Q Consensus       124 V~~gC~~Clm-YVMl~k~~P~CP~Cks~vll~f~  156 (173)
                      |.+-||.|.= .=|+-+.| .|+.|+.++.||=.
T Consensus        68 v~V~CP~C~K~TKmLGr~D-~CM~C~~pLTLd~~  100 (114)
T PF11023_consen   68 VQVECPNCGKQTKMLGRVD-ACMHCKEPLTLDPS  100 (114)
T ss_pred             eeeECCCCCChHhhhchhh-ccCcCCCcCccCch
Confidence            6777999998 55888887 99999999877733


No 16 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=51.68  E-value=17  Score=29.41  Aligned_cols=33  Identities=33%  Similarity=0.600  Sum_probs=22.9

Q ss_pred             CCcceEEeeCccceEEEEeeCCC--CCCCCCCCcc
Q 045532          119 EATSMVLVGCPRCLMYVMLSEDD--PKCPKCKSTV  151 (173)
Q Consensus       119 ~~~~mV~~gC~~ClmYVMl~k~~--P~CP~Cks~v  151 (173)
                      +...+=.-.|..|---+-+...+  |.||+|....
T Consensus       106 E~~g~G~l~C~~Cg~~~~~~~~~~l~~Cp~C~~~~  140 (146)
T PF07295_consen  106 EVVGPGTLVCENCGHEVELTHPERLPPCPKCGHTE  140 (146)
T ss_pred             cEecCceEecccCCCEEEecCCCcCCCCCCCCCCe
Confidence            43444455699998766555444  9999999776


No 17 
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=49.88  E-value=15  Score=24.98  Aligned_cols=17  Identities=24%  Similarity=0.004  Sum_probs=12.4

Q ss_pred             CCCCCCcchhccceeeeecc
Q 045532           28 LPFPHPRLAKALFSFYLKAG   47 (173)
Q Consensus        28 l~~plP~~WE~~~q~LDlqS   47 (173)
                      +++|+|.||+   +.+.+..
T Consensus         2 l~~P~p~GW~---R~~~~r~   18 (62)
T cd00122           2 LRDPLPPGWK---RELVIRK   18 (62)
T ss_pred             CCCCCCCCeE---EEEEEcC
Confidence            5678999995   6666543


No 18 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=49.72  E-value=8.4  Score=35.47  Aligned_cols=26  Identities=31%  Similarity=0.956  Sum_probs=19.4

Q ss_pred             EeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          125 LVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       125 ~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      ..+|+.|...+ -......||||+.+.
T Consensus       215 ~~~C~~Cd~~~-~~~~~a~CpRC~~~L  240 (403)
T TIGR00155       215 LRSCSACHTTI-LPAQEPVCPRCSTPL  240 (403)
T ss_pred             CCcCCCCCCcc-CCCCCcCCcCCCCcc
Confidence            45799999844 334557899999875


No 19 
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=49.45  E-value=19  Score=27.96  Aligned_cols=18  Identities=33%  Similarity=0.724  Sum_probs=14.0

Q ss_pred             CCcceEEeeCccceEEEE
Q 045532          119 EATSMVLVGCPRCLMYVM  136 (173)
Q Consensus       119 ~~~~mV~~gC~~ClmYVM  136 (173)
                      .....|+.||++|+.-++
T Consensus        43 ~~~vvvvggCp~CrvG~l   60 (98)
T PF10164_consen   43 VPQVVVVGGCPACRVGVL   60 (98)
T ss_pred             CCceEEecCCCCCceeee
Confidence            345788999999987555


No 20 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=49.14  E-value=15  Score=28.16  Aligned_cols=28  Identities=32%  Similarity=0.578  Sum_probs=22.2

Q ss_pred             EEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      +.+-|..|--++=+....-.||+|++.-
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (115)
T TIGR00100        69 VECECEDCSEEVSPEIDLYRCPKCHGIM   96 (115)
T ss_pred             cEEEcccCCCEEecCCcCccCcCCcCCC
Confidence            5688999997776666677799999863


No 21 
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=47.50  E-value=12  Score=31.96  Aligned_cols=32  Identities=25%  Similarity=0.625  Sum_probs=24.8

Q ss_pred             CCcceEEeeCccceEEEEeeCCCCCCCCCCCc
Q 045532          119 EATSMVLVGCPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       119 ~~~~mV~~gC~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      ..-..|.|-|.+|.--.+.....-+||+|..+
T Consensus       143 ~dlGVI~A~CsrC~~~L~~~~~~l~Cp~Cg~t  174 (188)
T COG1096         143 NDLGVIYARCSRCRAPLVKKGNMLKCPNCGNT  174 (188)
T ss_pred             CcceEEEEEccCCCcceEEcCcEEECCCCCCE
Confidence            34567899999999755555566899999965


No 22 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=47.42  E-value=16  Score=27.91  Aligned_cols=27  Identities=26%  Similarity=0.652  Sum_probs=21.2

Q ss_pred             EEeeCccceEEEEeeCCCCCCCCCCCc
Q 045532          124 VLVGCPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      +.+-|..|--++=+....-.||+|++.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQHDAQCPHCHGE   95 (113)
T ss_pred             cEEEcccCCCEEecCCcCccCcCCCCC
Confidence            567899999766665666679999976


No 23 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=45.90  E-value=17  Score=27.90  Aligned_cols=28  Identities=29%  Similarity=0.744  Sum_probs=21.4

Q ss_pred             EEeeCccceEEEEeeCCC-CCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLSEDD-PKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k~~-P~CP~Cks~v  151 (173)
                      +.+-|..|--++=+.... -.||+|++.-
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~~   97 (114)
T PRK03681         69 AECWCETCQQYVTLLTQRVRRCPQCHGDM   97 (114)
T ss_pred             cEEEcccCCCeeecCCccCCcCcCcCCCC
Confidence            578899999777665554 6699999763


No 24 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=43.06  E-value=11  Score=21.83  Aligned_cols=22  Identities=32%  Similarity=0.809  Sum_probs=14.4

Q ss_pred             eCccceEEEEeeCCCCCCCCCCCc
Q 045532          127 GCPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       127 gC~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      -|+.|--  .+....--||+|...
T Consensus         4 ~Cp~Cg~--~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    4 FCPNCGA--EIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCcccCC--cCCcccccChhhCCC
Confidence            4677766  356666777777654


No 25 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=43.01  E-value=11  Score=23.50  Aligned_cols=26  Identities=31%  Similarity=0.943  Sum_probs=18.2

Q ss_pred             EeeCccceEEEEeeCC-------CCCCCCCCCc
Q 045532          125 LVGCPRCLMYVMLSED-------DPKCPKCKST  150 (173)
Q Consensus       125 ~~gC~~ClmYVMl~k~-------~P~CP~Cks~  150 (173)
                      .+-||.|...+-|...       .-+||+|+..
T Consensus         2 ~i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~   34 (37)
T PF13719_consen    2 IITCPNCQTRFRVPDDKLPAGGRKVRCPKCGHV   34 (37)
T ss_pred             EEECCCCCceEEcCHHHcccCCcEEECCCCCcE
Confidence            3568999886666643       3579999854


No 26 
>COG5104 PRP40 Splicing factor [RNA processing and modification]
Probab=42.95  E-value=6.4  Score=38.05  Aligned_cols=28  Identities=21%  Similarity=0.087  Sum_probs=22.2

Q ss_pred             cchhccceeeeeccccE-EEeeccCcccCCCCC
Q 045532           34 RLAKALFSFYLKAGGGI-YRCVHTAKMSRRNGN   65 (173)
Q Consensus        34 ~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~~   65 (173)
                      ++||    -+--.+|+| |||++|.|.+|..|+
T Consensus        15 s~w~----e~k~~dgRiYYYN~~T~kS~weKPk   43 (590)
T COG5104          15 SEWE----ELKAPDGRIYYYNKRTGKSSWEKPK   43 (590)
T ss_pred             HHHH----HhhCCCCceEEEecccccccccChH
Confidence            4785    456678999 889999998887764


No 27 
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=42.86  E-value=14  Score=34.50  Aligned_cols=31  Identities=32%  Similarity=0.628  Sum_probs=25.5

Q ss_pred             cceEEeeCccce-EEEEeeCCCCCCCCCCCcc
Q 045532          121 TSMVLVGCPRCL-MYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       121 ~~mV~~gC~~Cl-mYVMl~k~~P~CP~Cks~v  151 (173)
                      ....+.-|.+|. .|-+....+.+||.|...+
T Consensus       236 ~~g~~~~c~~cg~~~~~~~~~~~~c~~Cg~~~  267 (380)
T COG1867         236 NLGYIYHCSRCGEIVGSFREVDEKCPHCGGKV  267 (380)
T ss_pred             hcCcEEEcccccceecccccccccCCcccccc
Confidence            445568899995 6888999999999999754


No 28 
>cd01397 HAT_MBD Methyl-CpG binding domains (MBD) present in putative chromatin remodelling factor such as BAZ2A; BAZ2A contains a MBD, DDT, PHD-type zinc finger and Bromo domain suggesting that BAZ2A might be associated with histone acetyltransferase (HAT) activity. The Drosophila melanogaster toutatis protein, a putative subunit of the chromatin-remodeling complex, and other such proteins in this group share a similar domain architecture with BAZ2A, as does the Caenorhabditis elegans flectin homolog.
Probab=42.37  E-value=23  Score=25.80  Aligned_cols=28  Identities=18%  Similarity=0.038  Sum_probs=17.3

Q ss_pred             CCCCCCcchhccceeeeec------cccE-EEeeccCc
Q 045532           28 LPFPHPRLAKALFSFYLKA------GGGI-YRCVHTAK   58 (173)
Q Consensus        28 l~~plP~~WE~~~q~LDlq------SGki-yln~rt~k   58 (173)
                      +-+|||.||+   |-+-+.      .|.| |+..+=.|
T Consensus         2 ~r~Pl~~GW~---Re~vir~~~~~~~~dV~Y~aPcGKk   36 (73)
T cd01397           2 LRVPLELGWR---RETRIRGLGGRIQGEVAYYAPCGKK   36 (73)
T ss_pred             ccCCCCCCce---eEEEeccCCCCccceEEEECCCCcc
Confidence            3468999996   666663      3457 55554433


No 29 
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32). RPA2 is a subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B; RPA2 DBD-D is a weak ssDNA-binding domain. RPA2 DBD-D is also involved in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change. N-terminal to human RPA2 DBD-D is a domain containing all the known phosphorylation sites of RPA. Human RPA2 is phosphorylated in a cell cycle depende
Probab=42.13  E-value=13  Score=27.16  Aligned_cols=10  Identities=50%  Similarity=1.461  Sum_probs=8.3

Q ss_pred             CCCCCCCCCC
Q 045532          139 EDDPKCPKCK  148 (173)
Q Consensus       139 k~~P~CP~Ck  148 (173)
                      ..+|+||+|+
T Consensus        82 ~~np~C~~C~   91 (91)
T cd04482          82 RENPVCPKCG   91 (91)
T ss_pred             EcCCcCCCCC
Confidence            3689999995


No 30 
>PRK00420 hypothetical protein; Validated
Probab=42.10  E-value=14  Score=28.98  Aligned_cols=34  Identities=21%  Similarity=0.531  Sum_probs=26.3

Q ss_pred             CcceEEeeCccceEEEE-eeCCCCCCCCCCCccee
Q 045532          120 ATSMVLVGCPRCLMYVM-LSEDDPKCPKCKSTVLL  153 (173)
Q Consensus       120 ~~~mV~~gC~~ClmYVM-l~k~~P~CP~Cks~vll  153 (173)
                      +.-|....||.|-+-.| +....-.||.|+..+.+
T Consensus        18 Ga~ml~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         18 GAKMLSKHCPVCGLPLFELKDGEVVCPVHGKVYIV   52 (112)
T ss_pred             HHHHccCCCCCCCCcceecCCCceECCCCCCeeee
Confidence            45678899999997444 46778999999986643


No 31 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=41.21  E-value=11  Score=23.24  Aligned_cols=12  Identities=50%  Similarity=0.941  Sum_probs=3.4

Q ss_pred             CCCCCCCCCcce
Q 045532          141 DPKCPKCKSTVL  152 (173)
Q Consensus       141 ~P~CP~Cks~vl  152 (173)
                      -|+||+|.+..-
T Consensus         2 ~p~Cp~C~se~~   13 (30)
T PF08274_consen    2 LPKCPLCGSEYT   13 (30)
T ss_dssp             S---TTT-----
T ss_pred             CCCCCCCCCcce
Confidence            489999998753


No 32 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=40.86  E-value=21  Score=21.65  Aligned_cols=23  Identities=30%  Similarity=0.579  Sum_probs=15.8

Q ss_pred             CccceEEEEeeCCCCCCCCCCCc
Q 045532          128 CPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       128 C~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      |.-|-...-..+.+.+||.|+..
T Consensus         4 C~~CGy~y~~~~~~~~CP~Cg~~   26 (33)
T cd00350           4 CPVCGYIYDGEEAPWVCPVCGAP   26 (33)
T ss_pred             CCCCCCEECCCcCCCcCcCCCCc
Confidence            66676544444567799999864


No 33 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=39.87  E-value=13  Score=21.96  Aligned_cols=20  Identities=40%  Similarity=0.918  Sum_probs=13.4

Q ss_pred             CccceEEEEeeCCCCCCCCCCC
Q 045532          128 CPRCLMYVMLSEDDPKCPKCKS  149 (173)
Q Consensus       128 C~~ClmYVMl~k~~P~CP~Cks  149 (173)
                      ||.|..-|  +...-.||.|..
T Consensus         3 CP~C~~~V--~~~~~~Cp~CG~   22 (26)
T PF10571_consen    3 CPECGAEV--PESAKFCPHCGY   22 (26)
T ss_pred             CCCCcCCc--hhhcCcCCCCCC
Confidence            67776654  556677888873


No 34 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=39.50  E-value=12  Score=28.54  Aligned_cols=29  Identities=28%  Similarity=0.415  Sum_probs=21.4

Q ss_pred             eEEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          123 MVLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       123 mV~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      -+.+-|..|-..+-+....-.||+|++..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (113)
T PF01155_consen   68 PARARCRDCGHEFEPDEFDFSCPRCGSPD   96 (113)
T ss_dssp             --EEEETTTS-EEECHHCCHH-SSSSSS-
T ss_pred             CCcEECCCCCCEEecCCCCCCCcCCcCCC
Confidence            35788999999888888888899999874


No 35 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=37.20  E-value=18  Score=25.45  Aligned_cols=16  Identities=44%  Similarity=0.904  Sum_probs=13.4

Q ss_pred             CCCCCCCCcceecccc
Q 045532          142 PKCPKCKSTVLLDFLH  157 (173)
Q Consensus       142 P~CP~Cks~vll~f~~  157 (173)
                      --||+|+...+|+.-+
T Consensus        29 lyCpKCK~EtlI~v~~   44 (55)
T PF14205_consen   29 LYCPKCKQETLIDVKQ   44 (55)
T ss_pred             ccCCCCCceEEEEeec
Confidence            4799999999988654


No 36 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=36.92  E-value=14  Score=29.75  Aligned_cols=28  Identities=21%  Similarity=0.607  Sum_probs=19.9

Q ss_pred             EEeeCccceEEEEee---CCCCCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLS---EDDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~---k~~P~CP~Cks~v  151 (173)
                      ..-.||+|..-+-.-   ..+-.||+|+.+.
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~~~F~Cp~Cg~~L  138 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAMELNFTCPRCGAML  138 (158)
T ss_pred             CeEECCCCCcEeeHHHHHHcCCcCCCCCCEe
Confidence            356799999733221   4579999999773


No 37 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=36.57  E-value=17  Score=33.71  Aligned_cols=25  Identities=32%  Similarity=0.890  Sum_probs=18.9

Q ss_pred             EeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          125 LVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       125 ~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      ..+|+.|...+  ....-.||||+...
T Consensus       221 l~~C~~Cd~l~--~~~~a~CpRC~~~L  245 (419)
T PRK15103        221 LRSCSCCTAIL--PADQPVCPRCHTKG  245 (419)
T ss_pred             CCcCCCCCCCC--CCCCCCCCCCCCcC
Confidence            55799999853  44556899999875


No 38 
>cd07973 Spt4 Transcription elongation factor Spt4. Spt4 is a transcription elongation factor. Three transcription-elongation factors Spt4, Spt5, and Spt6, are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles.   Spt4 functions entirely in the context of the Spt4-Spt5 heterodimer and it has been found only as a complex to Spt5 in Yeast and Human. Spt4 is a small protein that has zinc finger at the N-terminus.   Spt5 is a large protein that has several interesting structural features of an acidic N-terminus, a single NGN domain, five or six KOW domains, and a set of simple C-termianl repeats. Spt4 binds to Spt5 NGN domain. Unlike Spt5, Spt4 is not essential for viability in yeast, however Spt4 is critical for normal function of the Spt4-Spt5 compl
Probab=36.25  E-value=18  Score=27.61  Aligned_cols=23  Identities=22%  Similarity=0.605  Sum_probs=16.0

Q ss_pred             eeCccceEEEEee-CCCCCCCCCC
Q 045532          126 VGCPRCLMYVMLS-EDDPKCPKCK  148 (173)
Q Consensus       126 ~gC~~ClmYVMl~-k~~P~CP~Ck  148 (173)
                      -+|..|.+-+=.. .....||+|.
T Consensus         4 rAC~~C~~I~~~~qf~~~gCpnC~   27 (98)
T cd07973           4 RACLLCSLIKTEDQFERDGCPNCE   27 (98)
T ss_pred             chhccCCcccccccccCCCCCCCc
Confidence            3799999755222 2347999996


No 39 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=34.72  E-value=38  Score=26.62  Aligned_cols=27  Identities=33%  Similarity=0.581  Sum_probs=19.9

Q ss_pred             EEeeCccceEEEEee---------------------CCCCCCCCCCCc
Q 045532          124 VLVGCPRCLMYVMLS---------------------EDDPKCPKCKST  150 (173)
Q Consensus       124 V~~gC~~ClmYVMl~---------------------k~~P~CP~Cks~  150 (173)
                      +..-|+.|--.+=+.                     ...-.||+|++.
T Consensus        69 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         69 AVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             eEEECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCC
Confidence            678899998655444                     345679999976


No 40 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=33.58  E-value=19  Score=29.62  Aligned_cols=28  Identities=25%  Similarity=0.756  Sum_probs=20.1

Q ss_pred             EEeeCccceE-EEEe--eCCCCCCCCCCCcc
Q 045532          124 VLVGCPRCLM-YVML--SEDDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~Clm-YVMl--~k~~P~CP~Cks~v  151 (173)
                      ..-.|++|.. |-+.  ...+-.||.|+..+
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAMEYGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhhcCCcCCCCCCCC
Confidence            4667999987 4332  14579999999774


No 41 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=33.33  E-value=26  Score=28.35  Aligned_cols=30  Identities=13%  Similarity=0.111  Sum_probs=23.0

Q ss_pred             eCccceE-EEEeeCCCCCCCCCCCcceeccc
Q 045532          127 GCPRCLM-YVMLSEDDPKCPKCKSTVLLDFL  156 (173)
Q Consensus       127 gC~~Clm-YVMl~k~~P~CP~Cks~vll~f~  156 (173)
                      .|+.|-- ++=|.|.-..||+|+..+.+.++
T Consensus        11 ~Cp~cg~kFYDLnk~p~vcP~cg~~~~~~~~   41 (129)
T TIGR02300        11 ICPNTGSKFYDLNRRPAVSPYTGEQFPPEEA   41 (129)
T ss_pred             cCCCcCccccccCCCCccCCCcCCccCcchh
Confidence            5999977 33467777899999998877744


No 42 
>PRK11032 hypothetical protein; Provisional
Probab=33.12  E-value=54  Score=27.08  Aligned_cols=37  Identities=27%  Similarity=0.532  Sum_probs=23.7

Q ss_pred             CCcceEEeeCccceEEEEee--CCCCCCCCCCCcceeccccC
Q 045532          119 EATSMVLVGCPRCLMYVMLS--EDDPKCPKCKSTVLLDFLHD  158 (173)
Q Consensus       119 ~~~~mV~~gC~~ClmYVMl~--k~~P~CP~Cks~vll~f~~~  158 (173)
                      +...+=...|..|.--.-+-  ..-|.||+|+..-   |.+.
T Consensus       118 Evvg~G~LvC~~Cg~~~~~~~p~~i~pCp~C~~~~---F~R~  156 (160)
T PRK11032        118 EVVGLGNLVCEKCHHHLAFYTPEVLPLCPKCGHDQ---FQRR  156 (160)
T ss_pred             eeeecceEEecCCCCEEEecCCCcCCCCCCCCCCe---eeeC
Confidence            33334445699997644333  4559999999876   5544


No 43 
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=32.57  E-value=12  Score=31.43  Aligned_cols=27  Identities=30%  Similarity=0.677  Sum_probs=20.9

Q ss_pred             EeeCccceEEEEeeC---CCCCCCCCCCcc
Q 045532          125 LVGCPRCLMYVMLSE---DDPKCPKCKSTV  151 (173)
Q Consensus       125 ~~gC~~ClmYVMl~k---~~P~CP~Cks~v  151 (173)
                      .-.|+.|++++=+-+   ..-.||+|++.+
T Consensus       113 ~y~C~~~~~r~sfdeA~~~~F~Cp~Cg~~L  142 (176)
T COG1675         113 YYVCPNCHVKYSFDEAMELGFTCPKCGEDL  142 (176)
T ss_pred             ceeCCCCCCcccHHHHHHhCCCCCCCCchh
Confidence            445799999876653   458999999875


No 44 
>PF04074 DUF386:  Domain of unknown function (DUF386);  InterPro: IPR004375 This family consists of conserved hypothetical proteins, about 150 amino acids in length, with no known function. The family is restricted to the bacteria. It includes three members in Escherichia coli (strain K12) and three in Streptococcus pneumoniae.; PDB: 1S4C_B 1JOP_B.
Probab=32.55  E-value=18  Score=28.34  Aligned_cols=16  Identities=6%  Similarity=-0.139  Sum_probs=11.4

Q ss_pred             chhccceeeeec---cccE
Q 045532           35 LAKALFSFYLKA---GGGI   50 (173)
Q Consensus        35 ~WE~~~q~LDlq---SGki   50 (173)
                      .||.|++++|||   +|+-
T Consensus        62 ~~E~HrkyiDiq~~l~G~E   80 (153)
T PF04074_consen   62 RFESHRKYIDIQYVLEGEE   80 (153)
T ss_dssp             -EEE-SSEEEEEEEEES-E
T ss_pred             ceeeeccEEEEEeeccccE
Confidence            699999999998   4655


No 45 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=31.16  E-value=27  Score=26.83  Aligned_cols=28  Identities=29%  Similarity=0.495  Sum_probs=20.6

Q ss_pred             EEeeCccceEEEEeeC-CCCCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLSE-DDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k-~~P~CP~Cks~v  151 (173)
                      +.+-|..|--++=+.. ...+||+|++.-
T Consensus        70 ~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~~   98 (117)
T PRK00564         70 VELECKDCSHVFKPNALDYGVCEKCHSKN   98 (117)
T ss_pred             CEEEhhhCCCccccCCccCCcCcCCCCCc
Confidence            5778999996655544 345799999863


No 46 
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=30.15  E-value=29  Score=24.53  Aligned_cols=15  Identities=47%  Similarity=1.012  Sum_probs=11.8

Q ss_pred             eeCCCCCCCCCCCcc
Q 045532          137 LSEDDPKCPKCKSTV  151 (173)
Q Consensus       137 l~k~~P~CP~Cks~v  151 (173)
                      -....|.||.|++..
T Consensus        35 s~~~~p~CPlC~s~M   49 (59)
T PF14169_consen   35 SFEEEPVCPLCKSPM   49 (59)
T ss_pred             ccCCCccCCCcCCcc
Confidence            346679999999874


No 47 
>PF06582 DUF1136:  Repeat of unknown function (DUF1136);  InterPro: IPR010939 This family consists of several eukaryote specific repeats of unknown function. This repeat seems to always be found with IPR007110 from INTERPRO.
Probab=30.02  E-value=15  Score=22.29  Aligned_cols=15  Identities=20%  Similarity=0.308  Sum_probs=11.7

Q ss_pred             CCCCCCCcchhccce
Q 045532           27 FLPFPHPRLAKALFS   41 (173)
Q Consensus        27 ~l~~plP~~WE~~~q   41 (173)
                      .+|.+.|.+||++|+
T Consensus         2 ~~dTQhp~~lekIq~   16 (28)
T PF06582_consen    2 ILDTQHPESLEKIQE   16 (28)
T ss_pred             cccccCHHHHHHHHH
Confidence            468889999986654


No 48 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=29.78  E-value=35  Score=21.63  Aligned_cols=14  Identities=43%  Similarity=0.942  Sum_probs=11.3

Q ss_pred             eCCCCCCCCCCCcc
Q 045532          138 SEDDPKCPKCKSTV  151 (173)
Q Consensus       138 ~k~~P~CP~Cks~v  151 (173)
                      .+++-.||+|.++-
T Consensus         2 a~i~v~CP~C~s~~   15 (36)
T PF03811_consen    2 AKIDVHCPRCQSTE   15 (36)
T ss_pred             CcEeeeCCCCCCCC
Confidence            46778999999775


No 49 
>PF01429 MBD:  Methyl-CpG binding domain;  InterPro: IPR001739 Methylation at CpG dinucleotide, the most common DNA modification in eukaryotes, has been correlated with gene silencing associated with various phenomena such as genomic imprinting, transposon and chromosome X inactivation, differentiation, and cancer. Effects of DNA methylation are mediated through proteins which bind to symmetrically methylated CpGs. Such proteins contain a specific domain of ~70 residues, the methyl-CpG-binding domain (MBD), which is linked to additional domains associated with chromatin, such as the bromodomain, the AT hook motif,the SET domain, or the PHD finger. MBD-containing proteins appear to act as structural proteins, which recruit a variety of histone deacetylase (HDAC) complexes and chromatin remodelling factors, leading to chromatin compaction and, consequently, to transcriptional repression. The MBD of MeCP2, MBD1, MBD2, MBD4 and BAZ2 mediates binding to DNA, in case of MeCP2, MBD1 and MBD2 preferentially to methylated CpG. In case of human MBD3 and SETDB1 the MBD has been shown to mediate protein-protein interactions [, ]. The MBD folds into an alpha/beta sandwich structure comprising a layer of twisted beta sheet, backed by another layer formed by the alpha1 helix and a hairpin loop at the C terminus. These layers are both amphipathic, with the alpha1 helix and the beta sheet lying parallel and the hydrophobic faces tightly packed against each other. The beta sheet is composed of two long inner strands (beta2 and beta3) sandwiched by two shorter outer strands (beta1 and beta4) [].; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 2KY8_A 1UB1_A 1D9N_A 1IG4_A 1QK9_A 3C2I_A.
Probab=28.84  E-value=39  Score=23.97  Aligned_cols=10  Identities=40%  Similarity=0.258  Sum_probs=7.5

Q ss_pred             CCCCCCcchh
Q 045532           28 LPFPHPRLAK   37 (173)
Q Consensus        28 l~~plP~~WE   37 (173)
                      ++.|||.||.
T Consensus         7 ~~~~Lp~GW~   16 (77)
T PF01429_consen    7 LDPPLPDGWK   16 (77)
T ss_dssp             EBTTSTTT-E
T ss_pred             ccCCCCCCCE
Confidence            5779999995


No 50 
>PRK12496 hypothetical protein; Provisional
Probab=28.31  E-value=31  Score=28.03  Aligned_cols=26  Identities=27%  Similarity=0.372  Sum_probs=18.9

Q ss_pred             eeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          126 VGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       126 ~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      --|+.|.=++-.....-.||.|.+++
T Consensus       128 ~~C~gC~~~~~~~~~~~~C~~CG~~~  153 (164)
T PRK12496        128 KVCKGCKKKYPEDYPDDVCEICGSPV  153 (164)
T ss_pred             EECCCCCccccCCCCCCcCCCCCChh
Confidence            45999986554444445799999876


No 51 
>PRK10202 ebgC cryptic beta-D-galactosidase subunit beta; Reviewed
Probab=28.30  E-value=26  Score=27.95  Aligned_cols=20  Identities=10%  Similarity=-0.017  Sum_probs=15.8

Q ss_pred             Ccchhccceeeeec---cccEEE
Q 045532           33 PRLAKALFSFYLKA---GGGIYR   52 (173)
Q Consensus        33 P~~WE~~~q~LDlq---SGkiyl   52 (173)
                      |..||.|++++|||   +|+-++
T Consensus        56 ~~~~E~Hr~YiDIq~~l~G~E~i   78 (149)
T PRK10202         56 DALFTGHRRYFEVHYYLQGQQKI   78 (149)
T ss_pred             cccccccccEEEEEEEEeCeEEE
Confidence            35899999999998   576643


No 52 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=27.58  E-value=28  Score=27.44  Aligned_cols=28  Identities=39%  Similarity=0.562  Sum_probs=22.7

Q ss_pred             EEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      +..=|..|--++-+-..+-.||+|++..
T Consensus        69 ~~~~C~~C~~~~~~e~~~~~CP~C~s~~   96 (115)
T COG0375          69 AECWCLDCGQEVELEELDYRCPKCGSIN   96 (115)
T ss_pred             cEEEeccCCCeecchhheeECCCCCCCc
Confidence            4567999987887777788899999764


No 53 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=27.20  E-value=43  Score=30.92  Aligned_cols=27  Identities=33%  Similarity=0.849  Sum_probs=19.7

Q ss_pred             EeeCccceEEEEeeC----CCCCCCCCCCcc
Q 045532          125 LVGCPRCLMYVMLSE----DDPKCPKCKSTV  151 (173)
Q Consensus       125 ~~gC~~ClmYVMl~k----~~P~CP~Cks~v  151 (173)
                      ...|+.|-..+=++.    ..-.||||+...
T Consensus        13 ~~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L   43 (403)
T TIGR00155        13 HILCSQCDMLVALPRIESGQKAACPRCGTTL   43 (403)
T ss_pred             eeeCCCCCCcccccCCCCCCeeECCCCCCCC
Confidence            457999998665543    335699999875


No 54 
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=27.18  E-value=27  Score=33.07  Aligned_cols=27  Identities=30%  Similarity=0.790  Sum_probs=20.6

Q ss_pred             EEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      =...|..|+..-.- +..+.||||.+..
T Consensus       219 ~~~~C~~C~~~~~~-~~~~~CpRC~~~L  245 (418)
T COG2995         219 GLRSCLCCHYILPH-DAEPRCPRCGSKL  245 (418)
T ss_pred             cceecccccccCCH-hhCCCCCCCCChh
Confidence            35689999875443 3789999999875


No 55 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=27.15  E-value=26  Score=24.91  Aligned_cols=11  Identities=45%  Similarity=1.204  Sum_probs=8.3

Q ss_pred             CCCCCCCCCcc
Q 045532          141 DPKCPKCKSTV  151 (173)
Q Consensus       141 ~P~CP~Cks~v  151 (173)
                      .-+||+||...
T Consensus        24 e~KCPrCK~vN   34 (60)
T COG4416          24 EKKCPRCKEVN   34 (60)
T ss_pred             eecCCccceee
Confidence            46999999543


No 56 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=26.12  E-value=21  Score=25.75  Aligned_cols=26  Identities=35%  Similarity=0.652  Sum_probs=19.1

Q ss_pred             eEEeeCccceEEEEeeCCCCCCCCCCCc
Q 045532          123 MVLVGCPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       123 mV~~gC~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      |..-+|.+|+-.  +....--||.|.++
T Consensus         2 ~~~kAC~~Ck~l--~~~d~e~CP~Cgs~   27 (64)
T COG2093           2 STEKACKNCKRL--TPEDTEICPVCGST   27 (64)
T ss_pred             chhHHHhhcccc--CCCCCccCCCCCCc
Confidence            345689999753  35556679999998


No 57 
>TIGR00022 uncharacterized protein, YhcH/YjgK/YiaL family. This family consists of conserved hypothetical proteins, about 150 amino acids in length. Members with limited information include YhcH, a possible sugar isomerase of sialic acid catabolism, and YjgK.
Probab=25.94  E-value=28  Score=27.17  Aligned_cols=20  Identities=15%  Similarity=-0.071  Sum_probs=15.6

Q ss_pred             chhccceeeeec---cccEEEee
Q 045532           35 LAKALFSFYLKA---GGGIYRCV   54 (173)
Q Consensus        35 ~WE~~~q~LDlq---SGkiyln~   54 (173)
                      .||.|++++|||   +|+-++..
T Consensus        62 ~~E~Hr~YiDIq~~l~G~E~i~~   84 (142)
T TIGR00022        62 KAELHHRYLDIQLLLRGEENIEV   84 (142)
T ss_pred             chhhhhheEEEEEeecceEEEEE
Confidence            699999999998   57664433


No 58 
>PF03682 UPF0158:  Uncharacterised protein family (UPF0158);  InterPro: IPR005361 This is a small family of hypothetical bacterial proteins of unknown function.
Probab=25.78  E-value=42  Score=27.31  Aligned_cols=13  Identities=15%  Similarity=0.135  Sum_probs=11.0

Q ss_pred             ceeeeeccccEEE
Q 045532           40 FSFYLKAGGGIYR   52 (173)
Q Consensus        40 ~q~LDlqSGkiyl   52 (173)
                      +-+||+++|+||+
T Consensus        23 ~~yLD~~TGeI~~   35 (163)
T PF03682_consen   23 EYYLDLETGEIFY   35 (163)
T ss_pred             eEEEECCCCeEEE
Confidence            4899999999953


No 59 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=25.59  E-value=49  Score=23.00  Aligned_cols=24  Identities=29%  Similarity=0.906  Sum_probs=20.1

Q ss_pred             EEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          124 VLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       124 V~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      -+--|+.|-.|-+    ...||.|+...
T Consensus         4 ~mr~C~~CgvYTL----k~~CP~CG~~t   27 (56)
T PRK13130          4 KIRKCPKCGVYTL----KEICPVCGGKT   27 (56)
T ss_pred             cceECCCCCCEEc----cccCcCCCCCC
Confidence            3567999999998    67899999875


No 60 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=24.59  E-value=42  Score=23.27  Aligned_cols=13  Identities=31%  Similarity=0.866  Sum_probs=9.4

Q ss_pred             CCCCCCCCCCCcc
Q 045532          139 EDDPKCPKCKSTV  151 (173)
Q Consensus       139 k~~P~CP~Cks~v  151 (173)
                      +.++.||||...|
T Consensus        17 rk~~~CPrCG~gv   29 (51)
T COG1998          17 RKNRFCPRCGPGV   29 (51)
T ss_pred             EccccCCCCCCcc
Confidence            4567888888666


No 61 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=24.57  E-value=53  Score=30.51  Aligned_cols=26  Identities=38%  Similarity=0.998  Sum_probs=18.9

Q ss_pred             eeCccceEEEEeeC----CCCCCCCCCCcc
Q 045532          126 VGCPRCLMYVMLSE----DDPKCPKCKSTV  151 (173)
Q Consensus       126 ~gC~~ClmYVMl~k----~~P~CP~Cks~v  151 (173)
                      ..|+.|-..+=+..    ..-.||||....
T Consensus        11 ~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L   40 (419)
T PRK15103         11 ILCPQCDMLVALPRLEHGQKAACPRCGTTL   40 (419)
T ss_pred             ccCCCCCceeecCCCCCCCeeECCCCCCCC
Confidence            55999998665443    235699999876


No 62 
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=24.51  E-value=56  Score=23.27  Aligned_cols=25  Identities=32%  Similarity=0.879  Sum_probs=19.9

Q ss_pred             EeeCccceEEEEeeCCCCCCCCCCCccee
Q 045532          125 LVGCPRCLMYVMLSEDDPKCPKCKSTVLL  153 (173)
Q Consensus       125 ~~gC~~ClmYVMl~k~~P~CP~Cks~vll  153 (173)
                      .--|+.|.-|-|=    .+||.|...+.+
T Consensus         5 ~rkC~~cg~YTLk----e~Cp~CG~~t~~   29 (59)
T COG2260           5 IRKCPKCGRYTLK----EKCPVCGGDTKV   29 (59)
T ss_pred             hhcCcCCCceeec----ccCCCCCCcccc
Confidence            4569999999874    789999987643


No 63 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=24.08  E-value=50  Score=22.86  Aligned_cols=31  Identities=26%  Similarity=0.555  Sum_probs=18.2

Q ss_pred             eCccceEEEE----eeCCCCCCCCCCCcceecccc
Q 045532          127 GCPRCLMYVM----LSEDDPKCPKCKSTVLLDFLH  157 (173)
Q Consensus       127 gC~~ClmYVM----l~k~~P~CP~Cks~vll~f~~  157 (173)
                      -|..|.=..+    +....-|||||+....|.-..
T Consensus         6 RC~~CnklLa~~g~~~~leIKCpRC~tiN~~~a~~   40 (51)
T PF10122_consen    6 RCGHCNKLLAKAGEVIELEIKCPRCKTINHVRATS   40 (51)
T ss_pred             eccchhHHHhhhcCccEEEEECCCCCccceEeccC
Confidence            4666643222    224568999999776555443


No 64 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=23.92  E-value=36  Score=21.07  Aligned_cols=25  Identities=36%  Similarity=0.817  Sum_probs=16.6

Q ss_pred             CccceEEEEeeCCC-CCCCCCCCcce
Q 045532          128 CPRCLMYVMLSEDD-PKCPKCKSTVL  152 (173)
Q Consensus       128 C~~ClmYVMl~k~~-P~CP~Cks~vl  152 (173)
                      |..|-..|-+...+ -+||.|...++
T Consensus         3 C~~Cg~~~~~~~~~~irC~~CG~RIl   28 (32)
T PF03604_consen    3 CGECGAEVELKPGDPIRCPECGHRIL   28 (32)
T ss_dssp             ESSSSSSE-BSTSSTSSBSSSS-SEE
T ss_pred             CCcCCCeeEcCCCCcEECCcCCCeEE
Confidence            66777777666555 48999987764


No 65 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=23.75  E-value=70  Score=20.49  Aligned_cols=27  Identities=22%  Similarity=0.589  Sum_probs=17.2

Q ss_pred             EEeeCccceE-EEEeeC----CCCCCCCCCCc
Q 045532          124 VLVGCPRCLM-YVMLSE----DDPKCPKCKST  150 (173)
Q Consensus       124 V~~gC~~Clm-YVMl~k----~~P~CP~Cks~  150 (173)
                      ..--|..|-- +..+..    ....||.|.+.
T Consensus         4 Yey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~   35 (52)
T TIGR02605         4 YEYRCTACGHRFEVLQKMSDDPLATCPECGGE   35 (52)
T ss_pred             EEEEeCCCCCEeEEEEecCCCCCCCCCCCCCC
Confidence            3456888876 444432    23589999984


No 66 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=23.61  E-value=96  Score=19.65  Aligned_cols=25  Identities=40%  Similarity=0.765  Sum_probs=16.1

Q ss_pred             EeeCccce--EEEEee--C-CCCCCCCCCC
Q 045532          125 LVGCPRCL--MYVMLS--E-DDPKCPKCKS  149 (173)
Q Consensus       125 ~~gC~~Cl--mYVMl~--k-~~P~CP~Cks  149 (173)
                      ---|..|-  +-++.+  + ....||.|++
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEEcCCCCCCcCCCCCC
Confidence            34578887  234433  2 3479999997


No 67 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.85  E-value=53  Score=20.70  Aligned_cols=9  Identities=56%  Similarity=1.254  Sum_probs=6.2

Q ss_pred             CCCCCCCcc
Q 045532          143 KCPKCKSTV  151 (173)
Q Consensus       143 ~CP~Cks~v  151 (173)
                      +||+|++..
T Consensus         2 ~Cp~Cg~~~   10 (43)
T PF08271_consen    2 KCPNCGSKE   10 (43)
T ss_dssp             SBTTTSSSE
T ss_pred             CCcCCcCCc
Confidence            477777765


No 68 
>KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion]
Probab=22.46  E-value=1.5e+02  Score=24.76  Aligned_cols=36  Identities=25%  Similarity=0.625  Sum_probs=24.6

Q ss_pred             eEEeeCccce------EEEEeeCCC-CCCCCCCCcceeccccCC
Q 045532          123 MVLVGCPRCL------MYVMLSEDD-PKCPKCKSTVLLDFLHDK  159 (173)
Q Consensus       123 mV~~gC~~Cl------mYVMl~k~~-P~CP~Cks~vll~f~~~~  159 (173)
                      +..+|| .|.      +.+-|-|.+ ++||.|....-|-+..+.
T Consensus       109 ~RiVGC-~c~eD~~~V~Wmwl~Kge~~rc~eCG~~fkL~~v~~~  151 (153)
T KOG3352|consen  109 KRIVGC-GCEEDSHAVVWMWLEKGETQRCPECGHYFKLVPVGPV  151 (153)
T ss_pred             ceEEee-cccCCCcceEEEEEEcCCcccCCcccceEEeeecCCC
Confidence            458999 775      334466655 899999988766655443


No 69 
>PRK02935 hypothetical protein; Provisional
Probab=22.07  E-value=57  Score=25.80  Aligned_cols=37  Identities=35%  Similarity=0.565  Sum_probs=28.0

Q ss_pred             cceEEeeCccceE-EEEeeCCCCCCCCCCCcceeccccC
Q 045532          121 TSMVLVGCPRCLM-YVMLSEDDPKCPKCKSTVLLDFLHD  158 (173)
Q Consensus       121 ~~mV~~gC~~Clm-YVMl~k~~P~CP~Cks~vll~f~~~  158 (173)
                      ..-|.+-||.|.= .=|+-+.| .|.-|+.++-||=.++
T Consensus        66 tkavqV~CP~C~K~TKmLGrvD-~CM~C~~PLTLd~~le  103 (110)
T PRK02935         66 TKAVQVICPSCEKPTKMLGRVD-ACMHCNQPLTLDRSLE  103 (110)
T ss_pred             ccceeeECCCCCchhhhcccee-ecCcCCCcCCcCcccc
Confidence            3446779999998 55777766 8999999987774443


No 70 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=21.77  E-value=1.6e+02  Score=17.62  Aligned_cols=28  Identities=21%  Similarity=0.613  Sum_probs=17.7

Q ss_pred             eEEeeCccceE-EEEee----CCCCCCCCCCCc
Q 045532          123 MVLVGCPRCLM-YVMLS----EDDPKCPKCKST  150 (173)
Q Consensus       123 mV~~gC~~Clm-YVMl~----k~~P~CP~Cks~  150 (173)
                      +..--|+.|-- +..+.    .....||.|.+.
T Consensus         3 ~Y~y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~   35 (41)
T smart00834        3 IYEYRCEDCGHTFEVLQKISDDPLATCPECGGD   35 (41)
T ss_pred             CEEEEcCCCCCEEEEEEecCCCCCCCCCCCCCc
Confidence            34557888876 43333    234789999974


No 71 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=21.67  E-value=52  Score=27.39  Aligned_cols=25  Identities=28%  Similarity=0.515  Sum_probs=21.3

Q ss_pred             EeeCccceEEEEeeCCCCCCCCCCCc
Q 045532          125 LVGCPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       125 ~~gC~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      +-.|+.|-..+-. +..-+||-|+.+
T Consensus       134 ~~vC~vCGy~~~g-e~P~~CPiCga~  158 (166)
T COG1592         134 VWVCPVCGYTHEG-EAPEVCPICGAP  158 (166)
T ss_pred             EEEcCCCCCcccC-CCCCcCCCCCCh
Confidence            7789999887777 888899999954


No 72 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=21.53  E-value=62  Score=25.35  Aligned_cols=30  Identities=27%  Similarity=0.577  Sum_probs=23.4

Q ss_pred             ceEEeeCccceEEEEeeC-CCCCCCCCCCcc
Q 045532          122 SMVLVGCPRCLMYVMLSE-DDPKCPKCKSTV  151 (173)
Q Consensus       122 ~mV~~gC~~ClmYVMl~k-~~P~CP~Cks~v  151 (173)
                      .++-.+|+.|.=-|.-.. ....|++|...+
T Consensus        31 ~~~Y~aC~~C~kkv~~~~~~~~~C~~C~~~~   61 (166)
T cd04476          31 NWWYPACPGCNKKVVEEGNGTYRCEKCNKSV   61 (166)
T ss_pred             CeEEccccccCcccEeCCCCcEECCCCCCcC
Confidence            699999999988754333 568999999763


No 73 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=21.45  E-value=84  Score=19.32  Aligned_cols=23  Identities=39%  Similarity=0.898  Sum_probs=14.9

Q ss_pred             eCccceEEEEee-CCCCCCCCCCCc
Q 045532          127 GCPRCLMYVMLS-EDDPKCPKCKST  150 (173)
Q Consensus       127 gC~~ClmYVMl~-k~~P~CP~Cks~  150 (173)
                      -|..|- |++.. +.-.+||.|+..
T Consensus         4 ~C~~CG-~i~~g~~~p~~CP~Cg~~   27 (34)
T cd00729           4 VCPVCG-YIHEGEEAPEKCPICGAP   27 (34)
T ss_pred             ECCCCC-CEeECCcCCCcCcCCCCc
Confidence            477777 44433 344699999964


No 74 
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=21.10  E-value=33  Score=31.73  Aligned_cols=28  Identities=18%  Similarity=0.501  Sum_probs=18.3

Q ss_pred             eEEeeCccceEEEEeeC---CCCCCCCCCCcc
Q 045532          123 MVLVGCPRCLMYVMLSE---DDPKCPKCKSTV  151 (173)
Q Consensus       123 mV~~gC~~ClmYVMl~k---~~P~CP~Cks~v  151 (173)
                      --.+||.+|..-+-...   ..-+|| |+.++
T Consensus       238 Yh~~~c~~C~~~~~~~~~~~~~~~Cp-CG~~i  268 (374)
T TIGR00375       238 YHQTACEACGEPAVSEDAETACANCP-CGGRI  268 (374)
T ss_pred             cchhhhcccCCcCCchhhhhcCCCCC-CCCcc
Confidence            34789999964222222   137899 99985


No 75 
>COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair]
Probab=20.92  E-value=69  Score=28.83  Aligned_cols=27  Identities=33%  Similarity=0.667  Sum_probs=21.2

Q ss_pred             eEEeeCccceEEEEeeCCCCCCCCCCCcc
Q 045532          123 MVLVGCPRCLMYVMLSEDDPKCPKCKSTV  151 (173)
Q Consensus       123 mV~~gC~~ClmYVMl~k~~P~CP~Cks~v  151 (173)
                      .+--.|.-||--+  ++-.|+||.|+++.
T Consensus       258 ~~GfvCsVCLsvf--c~p~~~C~~C~skF  284 (296)
T COG5242         258 LLGFVCSVCLSVF--CRPVPVCKKCKSKF  284 (296)
T ss_pred             EEeeehhhhheee--cCCcCcCccccccc
Confidence            3445699998644  88889999999885


No 76 
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.63  E-value=43  Score=29.74  Aligned_cols=28  Identities=29%  Similarity=0.640  Sum_probs=19.8

Q ss_pred             cceEEeeCccceEEEEeeCCCCCCCCCCCc
Q 045532          121 TSMVLVGCPRCLMYVMLSEDDPKCPKCKST  150 (173)
Q Consensus       121 ~~mV~~gC~~ClmYVMl~k~~P~CP~Cks~  150 (173)
                      ...+.-.|+.|+-  ++++--+.||-|++.
T Consensus       251 ~v~~GyvCs~Cls--i~C~~p~~C~~Cgt~  278 (279)
T TIGR00627       251 LVSIGFVCSVCLS--VLCQYTPICKTCKTA  278 (279)
T ss_pred             cccceEECCCccC--CcCCCCCCCCCCCCC
Confidence            3445567999997  234555899999965


No 77 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=20.50  E-value=30  Score=30.33  Aligned_cols=30  Identities=23%  Similarity=0.448  Sum_probs=19.9

Q ss_pred             eEEeeCccceE--EEE----eeCCC--CCCCCCCCcce
Q 045532          123 MVLVGCPRCLM--YVM----LSEDD--PKCPKCKSTVL  152 (173)
Q Consensus       123 mV~~gC~~Clm--YVM----l~k~~--P~CP~Cks~vl  152 (173)
                      +.--.|-+|+|  +.+    |.+.|  ..||.|...+.
T Consensus       195 l~g~~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgRILy  232 (239)
T COG1579         195 LEGRVCGGCHMKLPSQTLSKVRKKDEIVFCPYCGRILY  232 (239)
T ss_pred             ecCCcccCCeeeecHHHHHHHhcCCCCccCCccchHHH
Confidence            33457999999  333    22333  79999997653


No 78 
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=20.27  E-value=22  Score=33.26  Aligned_cols=29  Identities=31%  Similarity=0.685  Sum_probs=20.5

Q ss_pred             eEEeeCccceEEEEee---CCCCCCCCCCCcc
Q 045532          123 MVLVGCPRCLMYVMLS---EDDPKCPKCKSTV  151 (173)
Q Consensus       123 mV~~gC~~ClmYVMl~---k~~P~CP~Cks~v  151 (173)
                      --.++|.+|..-+-+.   ..+-+||+|...+
T Consensus       244 Y~~TAC~rC~t~y~le~A~~~~wrCpkCGg~i  275 (403)
T COG1379         244 YHLTACSRCYTRYSLEEAKSLRWRCPKCGGKI  275 (403)
T ss_pred             hhHHHHHHhhhccCcchhhhhcccCcccccch
Confidence            3458999999733333   2458999999864


Done!