Query         045565
Match_columns 83
No_of_seqs    107 out of 153
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 03:21:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/045565.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/045565hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd06410 PB1_UP2 Uncharacterize  99.9 3.5E-25 7.5E-30  148.3   5.7   47   37-83      1-47  (97)
  2 smart00666 PB1 PB1 domain. Pho  97.8 3.2E-05   7E-10   47.4   4.3   33   50-83      3-35  (81)
  3 cd06408 PB1_NoxR The PB1 domai  96.6  0.0033 7.1E-08   42.1   4.0   28   56-83      9-36  (86)
  4 PF00564 PB1:  PB1 domain;  Int  96.6  0.0021 4.6E-08   39.2   2.8   32   52-83      5-36  (84)
  5 cd05992 PB1 The PB1 domain is   96.2  0.0095 2.1E-07   36.1   4.1   31   52-83      4-35  (81)
  6 cd06405 PB1_Mekk2_3 The PB1 do  96.2  0.0065 1.4E-07   40.8   3.4   27   57-83      8-34  (79)
  7 cd06407 PB1_NLP A PB1 domain i  95.2   0.038 8.2E-07   35.9   4.0   28   56-83      7-34  (82)
  8 cd06404 PB1_aPKC PB1 domain is  94.1   0.085 1.8E-06   35.4   3.7   29   55-83      6-34  (83)
  9 cd06398 PB1_Joka2 The PB1 doma  92.6    0.23 5.1E-06   32.9   4.0   29   53-82      5-38  (91)
 10 cd06406 PB1_P67 A PB1 domain i  91.7    0.31 6.7E-06   32.4   3.7   28   52-81      6-33  (80)
 11 cd06397 PB1_UP1 Uncharacterize  91.5    0.27 5.8E-06   33.2   3.3   26   57-82      8-33  (82)
 12 cd06401 PB1_TFG The PB1 domain  91.1    0.39 8.4E-06   32.1   3.7   26   57-82      8-34  (81)
 13 cd00196 UBQ Ubiquitin-like pro  90.2    0.99 2.1E-05   22.8   4.1   30   54-83      3-32  (69)
 14 cd06396 PB1_NBR1 The PB1 domai  89.7    0.63 1.4E-05   30.8   3.9   28   56-83      7-36  (81)
 15 cd01794 DC_UbP_C dendritic cel  87.5     1.3 2.7E-05   27.4   3.9   32   52-83      2-33  (70)
 16 cd01807 GDX_N ubiquitin-like d  86.4       2 4.4E-05   25.9   4.4   31   53-83      5-35  (74)
 17 cd01803 Ubiquitin Ubiquitin. U  86.3     1.9 4.1E-05   25.4   4.1   31   53-83      5-35  (76)
 18 cd01812 BAG1_N Ubiquitin-like   86.1     1.8 3.9E-05   25.3   3.9   30   53-83      5-34  (71)
 19 cd01809 Scythe_N Ubiquitin-lik  85.1     2.8 6.2E-05   24.4   4.4   31   53-83      5-35  (72)
 20 PTZ00044 ubiquitin; Provisiona  83.3     3.4 7.3E-05   24.7   4.3   31   53-83      5-35  (76)
 21 cd01796 DDI1_N DNA damage indu  83.0     2.7 5.9E-05   25.6   3.8   27   57-83      8-34  (71)
 22 cd01799 Hoil1_N Ubiquitin-like  80.7     3.5 7.5E-05   25.9   3.8   28   56-83     10-37  (75)
 23 cd01805 RAD23_N Ubiquitin-like  79.5     5.4 0.00012   23.8   4.3   31   53-83      5-35  (77)
 24 cd01806 Nedd8 Nebb8-like  ubiq  78.1     6.5 0.00014   23.0   4.3   30   54-83      6-35  (76)
 25 cd01810 ISG15_repeat2 ISG15 ub  78.1     5.1 0.00011   24.2   3.9   31   53-83      3-33  (74)
 26 PF11976 Rad60-SLD:  Ubiquitin-  77.4       5 0.00011   23.7   3.6   31   53-83      5-35  (72)
 27 cd01800 SF3a120_C Ubiquitin-li  74.2     6.7 0.00015   24.0   3.7   28   56-83      5-32  (76)
 28 cd01798 parkin_N amino-termina  74.0     8.6 0.00019   22.8   4.1   31   53-83      3-33  (70)
 29 PF14560 Ubiquitin_2:  Ubiquiti  73.7     4.4 9.5E-05   25.3   2.8   21   63-83     18-38  (87)
 30 cd01769 UBL Ubiquitin-like dom  73.7     9.3  0.0002   21.5   4.0   30   54-83      3-32  (69)
 31 smart00213 UBQ Ubiquitin homol  73.2      11 0.00023   21.0   4.1   30   53-83      5-34  (64)
 32 PF14107 DUF4280:  Domain of un  69.6     2.9 6.4E-05   27.2   1.4   16   31-46     87-102 (108)
 33 cd01802 AN1_N ubiquitin-like d  61.9      19  0.0004   23.9   4.1   31   53-83     32-62  (103)
 34 cd01804 midnolin_N Ubiquitin-l  59.9      21 0.00047   22.0   3.9   28   55-82      8-35  (78)
 35 cd06411 PB1_p51 The PB1 domain  58.6      15 0.00032   24.4   3.1   23   60-82      8-30  (78)
 36 cd01789 Alp11_N Ubiquitin-like  57.2      14  0.0003   23.4   2.7   21   63-83     17-37  (84)
 37 TIGR03831 YgiT_finger YgiT-typ  53.8     7.1 0.00015   21.2   0.9   27   37-66      3-31  (46)
 38 cd01813 UBP_N UBP ubiquitin pr  52.8      31 0.00068   21.3   3.8   27   57-83      8-34  (74)
 39 cd06403 PB1_Par6 The PB1 domai  51.9      26 0.00055   23.6   3.5   27   55-81      6-34  (80)
 40 cd01792 ISG15_repeat1 ISG15 ub  51.1      39 0.00084   20.7   4.0   30   54-83      8-37  (80)
 41 PF00240 ubiquitin:  Ubiquitin   48.3      43 0.00093   19.3   3.7   28   56-83      3-30  (69)
 42 cd01763 Sumo Small ubiquitin-r  46.5      39 0.00083   21.3   3.6   31   53-83     16-46  (87)
 43 PHA00008 J DNA packaging prote  45.3      12 0.00026   20.6   0.9    9   52-60     16-24  (26)
 44 cd01768 RA RA (Ras-associating  43.8      54  0.0012   19.9   3.8   28   56-83     10-37  (87)
 45 PF09740 DUF2043:  Uncharacteri  43.8      11 0.00023   26.5   0.7   21   32-52     84-104 (110)
 46 cd01808 hPLIC_N Ubiquitin-like  43.2      57  0.0012   19.3   3.8   26   57-83      9-34  (71)
 47 cd01793 Fubi Fubi ubiquitin-li  43.1      73  0.0016   19.1   4.3   27   57-83      7-33  (74)
 48 cd00754 MoaD Ubiquitin domain   42.0      38 0.00082   20.0   2.9   26   56-81     13-38  (80)
 49 cd06552 ASCH_yqfb_like ASC-1 h  42.0      27 0.00058   21.9   2.3   51   32-83     15-69  (100)
 50 PF11543 UN_NPL4:  Nuclear pore  40.9      32  0.0007   21.9   2.6   21   63-83     18-38  (80)
 51 KOG0695 Serine/threonine prote  40.4      38 0.00083   29.4   3.6   28   55-82     21-48  (593)
 52 cd04894 ACT_ACR-like_1 ACT dom  40.3      68  0.0015   21.2   4.0   39   40-82     24-68  (69)
 53 cd06402 PB1_p62 The PB1 domain  36.8      56  0.0012   21.8   3.3   24   59-82     15-40  (87)
 54 smart00314 RA Ras association   36.2      84  0.0018   19.2   3.9   27   56-82     13-39  (90)
 55 PF13889 Chromosome_seg:  Chrom  35.2      56  0.0012   20.5   2.9   29   33-71      8-36  (56)
 56 TIGR00165 S18 ribosomal protei  34.2      15 0.00033   23.6   0.3   16   35-51     28-43  (70)
 57 PF04663 Phenol_monoox:  Phenol  34.1      31 0.00067   22.4   1.7   31   49-79      9-46  (67)
 58 smart00295 B41 Band 4.1 homolo  33.8      81  0.0018   21.2   3.8   32   52-83      7-38  (207)
 59 PF09379 FERM_N:  FERM N-termin  33.3      67  0.0015   19.0   3.0   26   57-82      5-30  (80)
 60 PRK06437 hypothetical protein;  33.1      71  0.0015   19.5   3.1   26   53-78      5-30  (67)
 61 PF11784 DUF3320:  Protein of u  32.1      13 0.00028   22.1  -0.3   23   61-83     19-41  (52)
 62 PF12436 USP7_ICP0_bdg:  ICP0-b  31.8      47   0.001   24.9   2.6   32   48-83     78-109 (249)
 63 cd01797 NIRF_N amino-terminal   31.1 1.1E+02  0.0023   19.1   3.8   30   54-83      6-37  (78)
 64 PF04726 Microvir_J:  Microviru  30.4      24 0.00053   19.1   0.6    9   51-59     14-22  (24)
 65 TIGR03649 ergot_EASG ergot alk  30.0      73  0.0016   22.7   3.2   43   41-83    154-214 (285)
 66 cd01791 Ubl5 UBL5 ubiquitin-li  30.0 1.1E+02  0.0025   18.9   3.7   25   58-82     11-35  (73)
 67 CHL00077 rps18 ribosomal prote  29.8      20 0.00043   24.2   0.3   16   35-51     38-53  (86)
 68 PF00763 THF_DHG_CYH:  Tetrahyd  29.1      82  0.0018   21.0   3.2   27   56-82     57-83  (117)
 69 COG0424 Maf Nucleotide-binding  28.8      40 0.00088   25.4   1.8   15   37-51     73-87  (193)
 70 PF00614 PLDc:  Phospholipase D  28.4      35 0.00076   18.3   1.0   11   49-59     12-22  (28)
 71 cd02168 NMNAT_Nudix Nicotinami  28.3     6.7 0.00014   28.3  -2.4   16   39-55      3-18  (181)
 72 PRK01153 nicotinamide-nucleoti  26.4     7.3 0.00016   27.9  -2.4   17   39-56      4-20  (174)
 73 TIGR00601 rad23 UV excision re  25.2 1.2E+02  0.0026   24.7   4.0   31   53-83      5-35  (378)
 74 PF09992 DUF2233:  Predicted pe  24.6 1.9E+02  0.0042   19.5   4.4   42   40-81     74-128 (170)
 75 PF05678 VQ:  VQ motif;  InterP  24.4      54  0.0012   18.2   1.4   20   59-79      4-23  (31)
 76 KOG1722 60s ribosomal protein   24.1 1.3E+02  0.0029   22.5   3.7   38   37-77      5-57  (155)
 77 PF07929 PRiA4_ORF3:  Plasmid p  23.6 1.1E+02  0.0025   21.2   3.2   24   60-83     19-42  (179)
 78 COG2075 RPL24A Ribosomal prote  23.6 2.1E+02  0.0045   18.6   4.2   41   37-79      5-59  (66)
 79 PF02519 Auxin_inducible:  Auxi  23.1      92   0.002   20.8   2.5   36   48-83     37-76  (100)
 80 PF00788 RA:  Ras association (  23.0 1.8E+02  0.0038   17.3   3.8   25   59-83     17-41  (93)
 81 PF07045 DUF1330:  Protein of u  22.7      79  0.0017   18.8   2.0   19   38-57     16-34  (65)
 82 PF08856 DUF1826:  Protein of u  22.3      49  0.0011   24.5   1.2   17   32-48    112-131 (196)
 83 COG5470 Uncharacterized conser  22.3      87  0.0019   21.7   2.3   27   38-66     30-59  (96)
 84 PRK13600 putative ribosomal pr  22.0 1.5E+02  0.0032   19.5   3.3   24   58-82     28-51  (84)
 85 PF14832 Tautomerase_3:  Putati  21.9 1.2E+02  0.0026   21.4   3.0   28   53-80     50-84  (136)
 86 PF01084 Ribosomal_S18:  Riboso  21.8      11 0.00023   23.0  -2.0   15   35-50     17-31  (54)
 87 TIGR01687 moaD_arch MoaD famil  21.5 1.4E+02  0.0031   18.2   3.0   25   56-81     13-37  (88)
 88 PRK02240 GTP cyclohydrolase II  21.3 1.6E+02  0.0034   23.3   3.9   31   49-80    177-210 (254)
 89 PRK13793 nicotinamide-nucleoti  20.7      11 0.00024   28.2  -2.5   17   39-56      8-24  (196)
 90 cd04870 ACT_PSP_1 CT domains f  20.7 1.5E+02  0.0032   17.6   2.9   21   62-82     44-64  (75)
 91 KOG1513 Nuclear helicase MOP-3  20.6 1.1E+02  0.0024   29.2   3.3   25   59-83   1102-1126(1300)
 92 PF13186 SPASM:  Iron-sulfur cl  20.4 1.6E+02  0.0034   16.1   2.8   27   33-59      5-31  (64)
 93 cd06257 DnaJ DnaJ domain or J-  20.4      64  0.0014   17.6   1.2   22   61-82      4-25  (55)
 94 PF14847 Ras_bdg_2:  Ras-bindin  20.3 1.2E+02  0.0025   20.7   2.6   30   54-83      6-35  (105)
 95 PF01357 Pollen_allerg_1:  Poll  20.2      75  0.0016   20.1   1.6   15   52-66     17-31  (82)

No 1  
>cd06410 PB1_UP2 Uncharacterized protein 2. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=99.91  E-value=3.5e-25  Score=148.30  Aligned_cols=47  Identities=66%  Similarity=1.184  Sum_probs=46.0

Q ss_pred             EeecCCEeeeCCCCCCeEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           37 MCSFGGKILPRPHDNQLRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        37 lCSyGGrIlPRp~Dg~LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ||||||+|+|||+||||+|+|||||||+|+|++||+||++||+++|+
T Consensus         1 ~cs~GG~i~pr~~dg~l~Y~GG~tr~i~V~r~~s~~el~~kl~~~~~   47 (97)
T cd06410           1 LCSYGGRILPRPPDGQLRYVGGETRIVSVDRSISFKELVSKLSELFG   47 (97)
T ss_pred             CcccCCEEeCcCCCCCEEEcCCceEEEEEcCCCCHHHHHHHHHHHhC
Confidence            79999999999999999999999999999999999999999999985


No 2  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=97.84  E-value=3.2e-05  Score=47.43  Aligned_cols=33  Identities=45%  Similarity=0.739  Sum_probs=29.6

Q ss_pred             CCCeEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           50 DNQLRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        50 Dg~LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ..|++| ||++|.+.|+++++|.+|.+++.+.++
T Consensus         3 ~vK~~~-~~~~~~~~~~~~~s~~dL~~~i~~~~~   35 (81)
T smart00666        3 DVKLRY-GGETRRLSVPRDISFEDLRSKVAKRFG   35 (81)
T ss_pred             cEEEEE-CCEEEEEEECCCCCHHHHHHHHHHHhC
Confidence            357888 999999999999999999999998764


No 3  
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=96.64  E-value=0.0033  Score=42.12  Aligned_cols=28  Identities=21%  Similarity=0.362  Sum_probs=26.3

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .+||+|+|.|+.+|+|++|..|+.+.||
T Consensus         9 ~~~Dv~~i~v~~~i~f~dL~~kIrdkf~   36 (86)
T cd06408           9 AQDDTRYIMIGPDTGFADFEDKIRDKFG   36 (86)
T ss_pred             ecCcEEEEEcCCCCCHHHHHHHHHHHhC
Confidence            3899999999999999999999999986


No 4  
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=96.62  E-value=0.0021  Score=39.16  Aligned_cols=32  Identities=28%  Similarity=0.517  Sum_probs=25.9

Q ss_pred             CeEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           52 QLRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        52 ~LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      |++|-|+..|++.++++++|.+|..++++.+|
T Consensus         5 K~~~~~~~~~~~~~~~~~s~~~L~~~i~~~~~   36 (84)
T PF00564_consen    5 KVRYGGDIRRIISLPSDVSFDDLRSKIREKFG   36 (84)
T ss_dssp             EEEETTEEEEEEEECSTSHHHHHHHHHHHHHT
T ss_pred             EEEECCeeEEEEEcCCCCCHHHHHHHHHHHhC
Confidence            45665555555999999999999999998875


No 5  
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.24  E-value=0.0095  Score=36.06  Aligned_cols=31  Identities=32%  Similarity=0.546  Sum_probs=25.1

Q ss_pred             CeEEecCceeEEEEc-CCCChHHHHHHHHhhhC
Q 045565           52 QLRYVGGDTRIVAVH-RSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        52 ~LrYvGGeTRIisV~-R~isf~eL~~Kls~l~G   83 (83)
                      |++|- |++|.+.++ ++++|.+|.+++.+.++
T Consensus         4 K~~~~-~~~~~~~~~~~~~s~~~L~~~i~~~~~   35 (81)
T cd05992           4 KVKYG-GEIRRFVVVSRSISFEDLRSKIAEKFG   35 (81)
T ss_pred             EEEec-CCCEEEEEecCCCCHHHHHHHHHHHhC
Confidence            45555 677777887 99999999999998764


No 6  
>cd06405 PB1_Mekk2_3 The PB1 domain is present in the two mitogen-activated protein kinase kinases MEKK2 and MEKK3 which are two members of the signaling kinase cascade involved in angiogenesis and early cardiovascular development. The PB1 domain of MEKK2 (and/or MEKK3) interacts with the PB1 domain of another member of the kinase cascade Map2k5.  A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, f
Probab=96.18  E-value=0.0065  Score=40.84  Aligned_cols=27  Identities=30%  Similarity=0.541  Sum_probs=25.6

Q ss_pred             cCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           57 GGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        57 GGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      -||.|||.++|.+.|.||.+|....||
T Consensus         8 ~gEKRIi~f~RPvkf~dl~~kv~~afG   34 (79)
T cd06405           8 NGEKRIIQFPRPVKFKDLQQKVTTAFG   34 (79)
T ss_pred             cCceEEEecCCCccHHHHHHHHHHHhC
Confidence            489999999999999999999999887


No 7  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=95.18  E-value=0.038  Score=35.90  Aligned_cols=28  Identities=18%  Similarity=0.154  Sum_probs=25.9

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .|||++.+.++.+++|.+|.+++++.|+
T Consensus         7 ~~~d~~r~~l~~~~~~~~L~~~i~~r~~   34 (82)
T cd06407           7 YGEEKIRFRLPPSWGFTELKQEIAKRFK   34 (82)
T ss_pred             eCCeEEEEEcCCCCCHHHHHHHHHHHhC
Confidence            4899999999999999999999998874


No 8  
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=94.10  E-value=0.085  Score=35.45  Aligned_cols=29  Identities=17%  Similarity=0.305  Sum_probs=26.5

Q ss_pred             EecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           55 YVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        55 YvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +.+|+-+|..++.+++|.+|.+|+.++|.
T Consensus         6 ~y~gdi~it~~d~~~s~e~L~~~v~~~c~   34 (83)
T cd06404           6 AYNGDIMITSIDPSISLEELCNEVRDMCR   34 (83)
T ss_pred             EecCcEEEEEcCCCcCHHHHHHHHHHHhC
Confidence            45889999999999999999999999983


No 9  
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=92.58  E-value=0.23  Score=32.88  Aligned_cols=29  Identities=24%  Similarity=0.391  Sum_probs=25.1

Q ss_pred             eEEecCceeEEEEcC-----CCChHHHHHHHHhhh
Q 045565           53 LRYVGGDTRIVAVHR-----SSTFSTLLTKLSKLA   82 (83)
Q Consensus        53 LrYvGGeTRIisV~R-----~isf~eL~~Kls~l~   82 (83)
                      ..| ||++|-+.++-     +++|.+|..|+.++.
T Consensus         5 v~y-~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f   38 (91)
T cd06398           5 VKY-GGTLRRFTFPVAENQLDLNMDGLREKVEELF   38 (91)
T ss_pred             EEe-CCEEEEEEeccccccCCCCHHHHHHHHHHHh
Confidence            445 89999999994     799999999999875


No 10 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=91.71  E-value=0.31  Score=32.41  Aligned_cols=28  Identities=29%  Similarity=0.428  Sum_probs=24.4

Q ss_pred             CeEEecCceeEEEEcCCCChHHHHHHHHhh
Q 045565           52 QLRYVGGDTRIVAVHRSSTFSTLLTKLSKL   81 (83)
Q Consensus        52 ~LrYvGGeTRIisV~R~isf~eL~~Kls~l   81 (83)
                      |++|-+  |-.|.|+++++|++|..|+++-
T Consensus         6 KV~f~~--tIaIrvp~~~~y~~L~~ki~~k   33 (80)
T cd06406           6 KVHFKY--TVAIQVARGLSYATLLQKISSK   33 (80)
T ss_pred             EEEEEE--EEEEEcCCCCCHHHHHHHHHHH
Confidence            466776  9999999999999999999874


No 11 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=91.54  E-value=0.27  Score=33.21  Aligned_cols=26  Identities=35%  Similarity=0.429  Sum_probs=23.1

Q ss_pred             cCceeEEEEcCCCChHHHHHHHHhhh
Q 045565           57 GGDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        57 GGeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      +|+||=+++++..+|.+|.+||..|.
T Consensus         8 ~g~~RRf~~~~~pt~~~L~~kl~~Lf   33 (82)
T cd06397           8 LGDTRRIVFPDIPTWEALASKLENLY   33 (82)
T ss_pred             CCceEEEecCCCccHHHHHHHHHHHh
Confidence            67788888999999999999999875


No 12 
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=91.07  E-value=0.39  Score=32.13  Aligned_cols=26  Identities=27%  Similarity=0.553  Sum_probs=22.8

Q ss_pred             cCceeEEEEcC-CCChHHHHHHHHhhh
Q 045565           57 GGDTRIVAVHR-SSTFSTLLTKLSKLA   82 (83)
Q Consensus        57 GGeTRIisV~R-~isf~eL~~Kls~l~   82 (83)
                      |||.|.+.++. +++|.+|+..+.+++
T Consensus         8 g~DiR~~~~~~~~~t~~~L~~~v~~~F   34 (81)
T cd06401           8 GDDIRRIPIHNEDITYDELLLMMQRVF   34 (81)
T ss_pred             CCeEEEEeccCccccHHHHHHHHHHHh
Confidence            99999999997 589999999987553


No 13 
>cd00196 UBQ Ubiquitin-like proteins. Ubiquitin homologs; Includes ubiquitin and ubiquitin-like proteins. Ubiquitin-mediated proteolysis is part of the regulated turnover of proteins required for controlling cell cycle progression. Other family members are protein modifiers that perform a wide range of functions. Ubiquitination usually results in a covalent bond between the C-terminus of ubiquitin and the epsilon-amino group of a substrate lysine. The three-step mechanism requires an activating enzyme (E1) that forms a thiol ester with the C-terminal carboxy group, a conjugating enzyme (E2) that transiently carries the activated ubiquitin molecule as a thiol ester, and a ligase (E3) that transfers the activated ubiquitin from the E2 to the substrate lysine residue. In poly-ubiquitination, ubiquitin itself is the substrate.
Probab=90.22  E-value=0.99  Score=22.79  Aligned_cols=30  Identities=30%  Similarity=0.339  Sum_probs=25.5

Q ss_pred             EEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           54 RYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        54 rYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++-+|.+..+.++.+.+..+|.+++.+..|
T Consensus         3 ~~~~~~~~~~~~~~~~tv~~l~~~i~~~~~   32 (69)
T cd00196           3 KLNDGKTVELLVPSGTTVADLKEKLAKKLG   32 (69)
T ss_pred             EecCCCEEEEEcCCCCcHHHHHHHHHHHHC
Confidence            444899999999999999999999987643


No 14 
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=89.75  E-value=0.63  Score=30.85  Aligned_cols=28  Identities=14%  Similarity=0.279  Sum_probs=25.5

Q ss_pred             ecCceeEEEEcC--CCChHHHHHHHHhhhC
Q 045565           56 VGGDTRIVAVHR--SSTFSTLLTKLSKLAG   83 (83)
Q Consensus        56 vGGeTRIisV~R--~isf~eL~~Kls~l~G   83 (83)
                      .|||+..+.++.  +++|.+|.+.+.+.|+
T Consensus         7 y~~d~~rf~~~~~~~~~~~~L~~ev~~rf~   36 (81)
T cd06396           7 YNGESQSFLVSDSENTTWASVEAMVKVSFG   36 (81)
T ss_pred             ECCeEEEEEecCCCCCCHHHHHHHHHHHhC
Confidence            489999999999  8899999999999885


No 15 
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein. DC_UbP (dendritic cell derived ubiquitin-like protein) is a ubiquitin-like protein from human dendritic cells that is expressed in the mitochondrion. The ubiquitin-like domain of this protein is found at the C-terminus and lacks the canonical gly-gly motif of ubiquitin required for ubiquitinization.  DC_UbP is expressed in tumor cells but not in normal human adult tissue suggesting a role for DC_UbP in tumorogenesis.
Probab=87.46  E-value=1.3  Score=27.38  Aligned_cols=32  Identities=22%  Similarity=0.325  Sum_probs=28.6

Q ss_pred             CeEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           52 QLRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        52 ~LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      |++..+|+|..+.|+.+.+..+|.+++++..|
T Consensus         2 ~vk~~~G~~~~l~v~~~~TV~~lK~~I~~~~g   33 (70)
T cd01794           2 KVRLSTGKDVKLSVSSKDTVGQLKKQLQAAEG   33 (70)
T ss_pred             eEEcCCCCEEEEEECCcChHHHHHHHHHHHhC
Confidence            46788999999999999999999999988654


No 16 
>cd01807 GDX_N ubiquitin-like domain of GDX. GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain.  The function of GDX is unknown.
Probab=86.35  E-value=2  Score=25.95  Aligned_cols=31  Identities=19%  Similarity=0.235  Sum_probs=27.4

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .+..+|++..+.|+.+.+..+|.+++++..|
T Consensus         5 vk~~~G~~~~l~v~~~~tV~~lK~~i~~~~g   35 (74)
T cd01807           5 VKLLQGRECSLQVSEKESVSTLKKLVSEHLN   35 (74)
T ss_pred             EEeCCCCEEEEEECCCCcHHHHHHHHHHHHC
Confidence            4677899999999999999999999988654


No 17 
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=86.30  E-value=1.9  Score=25.37  Aligned_cols=31  Identities=23%  Similarity=0.356  Sum_probs=26.7

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++..+|++..+.|+.+.+..+|.+++++..|
T Consensus         5 v~~~~g~~~~~~v~~~~tV~~lK~~i~~~~g   35 (76)
T cd01803           5 VKTLTGKTITLEVEPSDTIENVKAKIQDKEG   35 (76)
T ss_pred             EEcCCCCEEEEEECCcCcHHHHHHHHHHHhC
Confidence            4556788999999999999999999998764


No 18 
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=86.12  E-value=1.8  Score=25.33  Aligned_cols=30  Identities=23%  Similarity=0.527  Sum_probs=26.2

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++| +|++.-+.|+.+.+..+|.+++++.+|
T Consensus         5 vk~-~g~~~~i~v~~~~tv~~lK~~i~~~~g   34 (71)
T cd01812           5 VKH-GGESHDLSISSQATFGDLKKMLAPVTG   34 (71)
T ss_pred             EEE-CCEEEEEEECCCCcHHHHHHHHHHhhC
Confidence            466 488888999999999999999998865


No 19 
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein. Scythe protein (also known as Bat3) is an apoptotic regulator that is highly conserved in eukaryotes and contains a ubiquitin-like domain near its N-terminus.  Scythe binds reaper, a potent apoptotic inducer, and Scythe/Reaper are thought to signal apoptosis, in part through regulating the folding and activity of apoptotic signaling molecules.
Probab=85.06  E-value=2.8  Score=24.36  Aligned_cols=31  Identities=19%  Similarity=0.282  Sum_probs=26.9

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .+...|++..+.|+.+.+..+|.+++++..|
T Consensus         5 vk~~~g~~~~~~v~~~~tv~~lK~~i~~~~g   35 (72)
T cd01809           5 VKTLDSQTHTFTVEEEITVLDLKEKIAEEVG   35 (72)
T ss_pred             EEeCCCCEEEEEECCCCcHHHHHHHHHHHHC
Confidence            4566788999999999999999999988765


No 20 
>PTZ00044 ubiquitin; Provisional
Probab=83.29  E-value=3.4  Score=24.70  Aligned_cols=31  Identities=13%  Similarity=0.253  Sum_probs=27.0

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +|-..|+|..+.|+.+.+-.+|.+++++..|
T Consensus         5 vk~~~G~~~~l~v~~~~tv~~lK~~i~~~~g   35 (76)
T PTZ00044          5 IKTLTGKKQSFNFEPDNTVQQVKMALQEKEG   35 (76)
T ss_pred             EEeCCCCEEEEEECCCCcHHHHHHHHHHHHC
Confidence            3556899999999999999999999998765


No 21 
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain. DDI1_N   DDI1 (DNA damage inducible protein 1) has an amino-terminal ubiquitin-like domain, an retroviral protease-like (RVP-like) domain, and a UBA (ubiquitin-associated) domain.  This CD represents the amino-terminal ubiquitin-like domain of DDI1.
Probab=83.00  E-value=2.7  Score=25.58  Aligned_cols=27  Identities=11%  Similarity=0.053  Sum_probs=25.1

Q ss_pred             cCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           57 GGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        57 GGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +|+|..|-|+.+.+..+|.+++++..|
T Consensus         8 ~g~~~~l~v~~~~TV~~lK~~I~~~~g   34 (71)
T cd01796           8 SETTFSLDVDPDLELENFKALCEAESG   34 (71)
T ss_pred             CCCEEEEEECCcCCHHHHHHHHHHHhC
Confidence            899999999999999999999998765


No 22 
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N   HOIL-1 (heme-oxidized IRP2 ubiquitin ligase-1) is an E3 ubiquitin-protein ligase that recognizes heme-oxidized IRP2 (iron regulatory protein2) and is thought to affect the turnover of oxidatively damaged proteins.  Hoil-1 has an amino-terminal ubiquitin-like domain as well as an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.
Probab=80.73  E-value=3.5  Score=25.92  Aligned_cols=28  Identities=21%  Similarity=0.033  Sum_probs=25.2

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .+|.|..|.|+.+.+..+|.+|+.+..|
T Consensus        10 ~~~~t~~l~v~~~~TV~~lK~kI~~~~g   37 (75)
T cd01799          10 SHTVTIWLTVRPDMTVAQLKDKVFLDYG   37 (75)
T ss_pred             cCCCeEEEEECCCCcHHHHHHHHHHHHC
Confidence            3688999999999999999999998765


No 23 
>cd01805 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belongs to a family of adaptor molecules having affinity for both the proteasome and ubiquitinylated proteins and thought to shuttle these ubiquitinylated proteins to the proteasome for destruction. RAD23 interacts with ubiquitin through its C-terminal ubiquitin-associated domains (UBA) and with the proteasome through its N-terminal ubiquitin-like domain (UBL).
Probab=79.55  E-value=5.4  Score=23.75  Aligned_cols=31  Identities=19%  Similarity=0.252  Sum_probs=27.3

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++..+|++..+.|+.+.+..+|.+++.+..|
T Consensus         5 vk~~~g~~~~l~v~~~~TV~~lK~~i~~~~~   35 (77)
T cd01805           5 FKTLKQQTFPIEVDPDDTVAELKEKIEEEKG   35 (77)
T ss_pred             EEeCCCCEEEEEECCCCcHHHHHHHHHHhhC
Confidence            5778999999999999999999999987654


No 24 
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=78.13  E-value=6.5  Score=23.03  Aligned_cols=30  Identities=7%  Similarity=0.246  Sum_probs=25.2

Q ss_pred             EEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           54 RYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        54 rYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +-.+|++-.+.|+.+.+..+|.+++.+..|
T Consensus         6 ~~~~g~~~~~~v~~~~tv~~lK~~i~~~~g   35 (76)
T cd01806           6 KTLTGKEIEIDIEPTDKVERIKERVEEKEG   35 (76)
T ss_pred             EeCCCCEEEEEECCCCCHHHHHHHHhHhhC
Confidence            445688888999999999999999988654


No 25 
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains and becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=78.10  E-value=5.1  Score=24.24  Aligned_cols=31  Identities=26%  Similarity=0.298  Sum_probs=26.9

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .|...|+|..+.|+.+.+..+|.+++++..|
T Consensus         3 vk~~~g~~~~l~v~~~~tV~~lK~~I~~~~g   33 (74)
T cd01810           3 VRNDKGRSSIYEVQLTQTVATLKQQVSQRER   33 (74)
T ss_pred             EECCCCCEEEEEECCcChHHHHHHHHHHHhC
Confidence            4567899999999999999999999987654


No 26 
>PF11976 Rad60-SLD:  Ubiquitin-2 like Rad60 SUMO-like;  InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair []. Unlike ubiquitin, they are not involved in protein degradation.  This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.; PDB: 3RD2_A 2JXX_A 3RCZ_A 3GOE_A 3A4S_D 3A4R_B 2IO1_D 1U4A_A 2K1F_A 1WZ0_A ....
Probab=77.37  E-value=5  Score=23.68  Aligned_cols=31  Identities=26%  Similarity=0.342  Sum_probs=26.5

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      |+-.+|++--+.|.++.+|+.|+.+.++..|
T Consensus         5 v~~~~~~~~~~~v~~~~~~~~l~~~~~~~~~   35 (72)
T PF11976_consen    5 VRSQDGKEIKFKVKPTTTVSKLIEKYCEKKG   35 (72)
T ss_dssp             EEETTSEEEEEEEETTSCCHHHHHHHHHHHT
T ss_pred             EEeCCCCEEEEEECCCCcHHHHHHHHHHhhC
Confidence            5667788888999999999999999987654


No 27 
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120. SF3a120_C  Mammalian splicing factor SF3a consists of three subunits of 60, 66, and 120 kDa and functions early during pre-mRNA splicing by converting the U2 snRNP to its active form.  The 120kDa subunit (SF3a120) has a carboxy-terminal ubiquitin-like domain and two SWAP (suppressor-of-white-apricot) domains, referred to collectively as the SURP module, at its amino-terminus.
Probab=74.24  E-value=6.7  Score=23.96  Aligned_cols=28  Identities=21%  Similarity=0.287  Sum_probs=25.0

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .+|+|..|.|+.+.+..+|.+++.+..|
T Consensus         5 l~g~~~~l~v~~~~TV~~lK~~i~~~~g   32 (76)
T cd01800           5 LNGQMLNFTLQLSDPVSVLKVKIHEETG   32 (76)
T ss_pred             cCCeEEEEEECCCCcHHHHHHHHHHHHC
Confidence            4789999999999999999999988754


No 28 
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein. parkin_N  parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.  Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of  26S proteasomes through its Ubl domain.
Probab=74.05  E-value=8.6  Score=22.84  Aligned_cols=31  Identities=26%  Similarity=0.268  Sum_probs=26.9

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .+...|++..+.|+.+.+..+|.+++++..|
T Consensus         3 vk~~~g~~~~~~v~~~~tV~~lK~~i~~~~g   33 (70)
T cd01798           3 VRTNTGHTFPVEVDPDTDIKQLKEVVAKRQG   33 (70)
T ss_pred             EEcCCCCEEEEEECCCChHHHHHHHHHHHHC
Confidence            3567899999999999999999999987654


No 29 
>PF14560 Ubiquitin_2:  Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A.
Probab=73.72  E-value=4.4  Score=25.35  Aligned_cols=21  Identities=43%  Similarity=0.449  Sum_probs=19.5

Q ss_pred             EEEcCCCChHHHHHHHHhhhC
Q 045565           63 VAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        63 isV~R~isf~eL~~Kls~l~G   83 (83)
                      +.++.++++.||..||..++|
T Consensus        18 kr~~~~~Tv~eLK~kl~~~~G   38 (87)
T PF14560_consen   18 KRFPKSITVSELKQKLEKLTG   38 (87)
T ss_dssp             EEEETTSBHHHHHHHHHHHHT
T ss_pred             EEcCCCCCHHHHHHHHHHHhC
Confidence            578999999999999999987


No 30 
>cd01769 UBL Ubiquitin-like domain of UBL. UBLs function by remodeling the surface of their target proteins, changing their target's half-life, enzymatic activity, protein-protein interactions, subcellular localization or other properties. At least 10 different ubiquitin-like modifications exist in mammals, and attachment of different ubls to a target leads to different biological consequences. Ubl-conjugation cascades are initiated by activating enzymes, which also coordinate the ubls with their downstream pathways.
Probab=73.65  E-value=9.3  Score=21.47  Aligned_cols=30  Identities=23%  Similarity=0.308  Sum_probs=24.6

Q ss_pred             EEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           54 RYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        54 rYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +...|.+-.+.++.+.+..+|.+++++.+|
T Consensus         3 ~~~~~~~~~~~~~~~~ti~~lK~~i~~~~~   32 (69)
T cd01769           3 KTLTGKTFELEVSPDDTVAELKAKIAAKEG   32 (69)
T ss_pred             EccCCCEEEEEECCCChHHHHHHHHHHHHC
Confidence            445677777899999999999999998765


No 31 
>smart00213 UBQ Ubiquitin homologues. Ubiquitin-mediated proteolysis is involved in the regulated turnover of  proteins required for controlling cell cycle progression
Probab=73.22  E-value=11  Score=20.97  Aligned_cols=30  Identities=30%  Similarity=0.420  Sum_probs=24.2

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++..+ .+.-+.|+.+.+..+|.+++.+..|
T Consensus         5 vk~~~-~~~~~~v~~~~tv~~lk~~i~~~~~   34 (64)
T smart00213        5 VKTLD-GTITLEVKPSDTVSELKEKIAELTG   34 (64)
T ss_pred             EEECC-ceEEEEECCCCcHHHHHHHHHHHHC
Confidence            34555 5777899999999999999988764


No 32 
>PF14107 DUF4280:  Domain of unknown function (DUF4280)
Probab=69.58  E-value=2.9  Score=27.20  Aligned_cols=16  Identities=25%  Similarity=0.615  Sum_probs=12.9

Q ss_pred             CCeEEEEeecCCEeee
Q 045565           31 LTRVRFMCSFGGKILP   46 (83)
Q Consensus        31 ~~kvKllCSyGGrIlP   46 (83)
                      ..+=+++|.|||.|-.
T Consensus        87 ~~~S~~~C~~gG~I~i  102 (108)
T PF14107_consen   87 TEDSKLTCAYGGIISI  102 (108)
T ss_pred             ccCeEEeccCCCEEEE
Confidence            3467899999999865


No 33 
>cd01802 AN1_N ubiquitin-like domain of AN1. AN1 (also known as ANUBL1 and RSD-7) is ubiquitin-like protein with a testis-specific expression in rats that has an N-terminal ubiquitin-like domain and a C-terminal zinc-binding domain. Unlike ubiquitin polyproteins and most ubiquitin fusion proteins, the N-terminal ubiquitin-like domain of An1 does not undergo proteolytic processing.  The function of AN1 is unknown.
Probab=61.91  E-value=19  Score=23.91  Aligned_cols=31  Identities=19%  Similarity=0.273  Sum_probs=27.0

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++-.+|++..|-|+.+.+-.+|.+++++.-|
T Consensus        32 Vk~l~G~~~~leV~~~~TV~~lK~kI~~~~g   62 (103)
T cd01802          32 IETLTGTCFELRVSPFETVISVKAKIQRLEG   62 (103)
T ss_pred             EEcCCCCEEEEEeCCCCcHHHHHHHHHHHhC
Confidence            4667899999999999999999999987643


No 34 
>cd01804 midnolin_N Ubiquitin-like domain of midnolin. midnolin_N   Midnolin (midbrain nucleolar protein) is expressed in the nucleolus and is thought to regulate genes involved in neurogenesis.  Midnolin contains an amino-terminal ubiquitin-like domain.
Probab=59.85  E-value=21  Score=22.00  Aligned_cols=28  Identities=18%  Similarity=0.132  Sum_probs=23.7

Q ss_pred             EecCceeEEEEcCCCChHHHHHHHHhhh
Q 045565           55 YVGGDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        55 YvGGeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      -..|.+..|.|+.+.+..+|.+++++..
T Consensus         8 ~~~G~~~~l~v~~~~TV~~LK~~I~~~~   35 (78)
T cd01804           8 STTGTRFDLSVPPDETVEGLKKRISQRL   35 (78)
T ss_pred             ECCCCEEEEEECCcCHHHHHHHHHHHHh
Confidence            3457778899999999999999998754


No 35 
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein.  p51 plays an  important role in NADPH oxidase activation during phagosytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain mo
Probab=58.61  E-value=15  Score=24.42  Aligned_cols=23  Identities=26%  Similarity=0.226  Sum_probs=20.4

Q ss_pred             eeEEEEcCCCChHHHHHHHHhhh
Q 045565           60 TRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        60 TRIisV~R~isf~eL~~Kls~l~   82 (83)
                      |-.|.|+|.++|++|..++++-.
T Consensus         8 TVai~v~~g~~y~~L~~~ls~kL   30 (78)
T cd06411           8 TVALRAPRGADVSSLRALLSQAL   30 (78)
T ss_pred             EEEEEccCCCCHHHHHHHHHHHh
Confidence            77899999999999999998753


No 36 
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B. Alp11, also known as tubulin-folding cofactor B, is one of at least three proteins required for the proper folding of tubulins prior to their incorporation into microtubules.  These cofactors are necessary for the biogenesis of microtubules and for cell viability.  Alp11 has three domains including an N-terminal ubiquitin-like domain (represented by this CD) which executes the essential function, a central coiled-coil domain necessary for maintenance of cellular alpha-tubulin levels, and a C-terminal CLIP-170 domain is required for efficient binding to alpha-tubulin.
Probab=57.15  E-value=14  Score=23.40  Aligned_cols=21  Identities=29%  Similarity=0.317  Sum_probs=18.9

Q ss_pred             EEEcCCCChHHHHHHHHhhhC
Q 045565           63 VAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        63 isV~R~isf~eL~~Kls~l~G   83 (83)
                      ..++.+++.++|..||..++|
T Consensus        17 kr~~~~~Tv~~lK~kl~~~~G   37 (84)
T cd01789          17 KKYSRGLTIAELKKKLELVVG   37 (84)
T ss_pred             EecCCCCcHHHHHHHHHHHHC
Confidence            458999999999999999887


No 37 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=53.77  E-value=7.1  Score=21.16  Aligned_cols=27  Identities=30%  Similarity=0.701  Sum_probs=18.8

Q ss_pred             EeecCCEeeeCCC-CCCeEEecCceeEE-EEc
Q 045565           37 MCSFGGKILPRPH-DNQLRYVGGDTRIV-AVH   66 (83)
Q Consensus        37 lCSyGGrIlPRp~-Dg~LrYvGGeTRIi-sV~   66 (83)
                      +|  ||.-+.+-. +-.+.| ||+..+| .|+
T Consensus         3 ~C--~~~~~~~~~~~~~~~~-~~~~~~i~~vp   31 (46)
T TIGR03831         3 IC--GGEELEGKTTTETYEY-GGELIVIENVP   31 (46)
T ss_pred             CC--CCceecceEEEEEEEe-CCEEEEEeCCC
Confidence            46  677777665 667888 8888777 444


No 38 
>cd01813 UBP_N UBP ubiquitin processing protease. The UBP (ubiquitin processing protease) domain (also referred to as USP which stands for "ubiquitin-specific protease") is present at in a large family of cysteine proteases that specifically cleave ubiquitin conjugates.  This family includes Rpn11, UBP6 (USP14), USP7 (HAUSP).   This domain is closely related to the amino-terminal ubiquitin-like domain of BAG1 (Bcl2-associated anthanogene1) protein and is found only in eukaryotes.
Probab=52.80  E-value=31  Score=21.30  Aligned_cols=27  Identities=26%  Similarity=0.326  Sum_probs=23.9

Q ss_pred             cCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           57 GGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        57 GGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +|++.-|.|+.+.+..+|.++|.++.|
T Consensus         8 ~g~~~~v~v~~~~Tv~~lK~~i~~~tg   34 (74)
T cd01813           8 GGQEYSVTTLSEDTVLDLKQFIKTLTG   34 (74)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHC
Confidence            678888999999999999999998754


No 39 
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=51.90  E-value=26  Score=23.58  Aligned_cols=27  Identities=19%  Similarity=0.333  Sum_probs=23.8

Q ss_pred             EecCceeEEEEcCC--CChHHHHHHHHhh
Q 045565           55 YVGGDTRIVAVHRS--STFSTLLTKLSKL   81 (83)
Q Consensus        55 YvGGeTRIisV~R~--isf~eL~~Kls~l   81 (83)
                      +.++|+|=.+++|+  .+|.|+.+.+..+
T Consensus         6 kfdaEfRRFsl~r~~~~~f~ef~~ll~~l   34 (80)
T cd06403           6 KFDAEFRRFSLDRNKPGKFEDFYKLLEHL   34 (80)
T ss_pred             ccCCeEEEEEeccccCcCHHHHHHHHHHH
Confidence            46899999999998  8999999888765


No 40 
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains that becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=51.10  E-value=39  Score=20.73  Aligned_cols=30  Identities=27%  Similarity=0.488  Sum_probs=24.9

Q ss_pred             EEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           54 RYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        54 rYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +-..|++-.+.|+.+.+-.+|..++++..|
T Consensus         8 k~~~G~~~~~~v~~~~TV~~lK~~I~~~~~   37 (80)
T cd01792           8 KMLGGNEFLVSLRDSMTVSELKQQIAQKIG   37 (80)
T ss_pred             EeCCCCEEEEEcCCCCcHHHHHHHHHHHhC
Confidence            445688888899999999999999987654


No 41 
>PF00240 ubiquitin:  Ubiquitin family;  InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade. There are many different E3 ligases, which are responsible for the type of ubiquitin chain formed, the specificity of the target protein, and the regulation of the ubiquitinylation process []. Ubiquitinylation is an important regulatory tool that controls the concentration of key signalling proteins, such as those involved in cell cycle control, as well as removing misfolded, damaged or mutant proteins that could be harmful to the cell. Several ubiquitin-like molecules have been discovered, such as Ufm1 (IPR005375 from INTERPRO), SUMO1 (IPR003653 from INTERPRO), NEDD8, Rad23 (IPR004806 from INTERPRO), Elongin B and Parkin (IPR003977 from INTERPRO), the latter being involved in Parkinson's disease []. Ubiquitin is a protein of 76 amino acid residues, found in all eukaryotic cells and whose sequence is extremely well conserved from protozoan to vertebrates. Ubiquitin acts through its post-translational attachment (ubiquitinylation) to other proteins, where these modifications alter the function, location or trafficking of the protein, or targets it for destruction by the 26S proteasome []. The terminal glycine in the C-terminal 4-residue tail of ubiquitin can form an isopeptide bond with a lysine residue in the target protein, or with a lysine in another ubiquitin molecule to form a ubiquitin chain that attaches itself to a target protein. Ubiquitin has seven lysine residues, any one of which can be used to link ubiquitin molecules together, resulting in different structures that alter the target protein in different ways. It appears that Lys(11)-, Lys(29) and Lys(48)-linked poly-ubiquitin chains target the protein to the proteasome for degradation, while mono-ubiquitinylated and Lys(6)- or Lys(63)-linked poly-ubiquitin chains signal reversible modifications in protein activity, location or trafficking []. For example, Lys(63)-linked poly-ubiquitinylation is known to be involved in DNA damage tolerance, inflammatory response, protein trafficking and signal transduction through kinase activation []. In addition, the length of the ubiquitin chain alters the fate of the target protein. Regulatory proteins such as transcription factors and histones are frequent targets of ubquitinylation [].; GO: 0005515 protein binding; PDB: 2DZI_A 2XEW_E 3NOB_E 2KWU_B 2Y5B_F 3PHD_G 2KWV_B 2KOX_A 2XK5_B 3NHE_B ....
Probab=48.27  E-value=43  Score=19.29  Aligned_cols=28  Identities=25%  Similarity=0.382  Sum_probs=24.6

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ..|.+-.+.|+.+.+..+|..++++..|
T Consensus         3 ~~g~~~~~~v~~~~tV~~lK~~i~~~~~   30 (69)
T PF00240_consen    3 LSGKTFTLEVDPDDTVADLKQKIAEETG   30 (69)
T ss_dssp             TTSEEEEEEEETTSBHHHHHHHHHHHHT
T ss_pred             CCCcEEEEEECCCCCHHHhhhhcccccc
Confidence            4688889999999999999999998754


No 42 
>cd01763 Sumo Small ubiquitin-related modifier (SUMO). Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability.  SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases.
Probab=46.47  E-value=39  Score=21.26  Aligned_cols=31  Identities=16%  Similarity=0.356  Sum_probs=25.1

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++..-|.+..+.|.++.++..|+.+.++.-|
T Consensus        16 v~~~~g~~~~~~v~~~~~l~~l~~~y~~~~g   46 (87)
T cd01763          16 VKGQDGNEVFFKIKRSTPLKKLMEAYCQRQG   46 (87)
T ss_pred             EECCCCCEEEEEEcCCCHHHHHHHHHHHHhC
Confidence            3445677888999999999999999887543


No 43 
>PHA00008 J DNA packaging protein
Probab=45.27  E-value=12  Score=20.62  Aligned_cols=9  Identities=56%  Similarity=1.047  Sum_probs=7.4

Q ss_pred             CeEEecCce
Q 045565           52 QLRYVGGDT   60 (83)
Q Consensus        52 ~LrYvGGeT   60 (83)
                      .|.||||..
T Consensus        16 RLWYVGGtQ   24 (26)
T PHA00008         16 RLWYVGGTQ   24 (26)
T ss_pred             EEEEeccEE
Confidence            599999963


No 44 
>cd01768 RA RA (Ras-associating) ubiquitin domain. The RA (Ras-associating) domain is structurally similar to ubiquitin and is present in one or two copies in a number of signalling molecules that bind and regulate a small GTPase called Ras or the Ras-related GTPases, Ral and Rap. RA-containing proteins include RalGDS, AF6, RIN1, RASSF1, SNX27, CYR1, STE50, and phospholipase C epsilon.
Probab=43.81  E-value=54  Score=19.94  Aligned_cols=28  Identities=25%  Similarity=0.421  Sum_probs=24.1

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .+|..+.|.|+++.+-++++..+.+-+|
T Consensus        10 ~~~~~kti~V~~~~t~~~Vi~~~l~k~~   37 (87)
T cd01768          10 SGGTYKTLRVSKDTTAQDVIQQLLKKFG   37 (87)
T ss_pred             CCccEEEEEECCCCCHHHHHHHHHHHhC
Confidence            4788899999999999999998877543


No 45 
>PF09740 DUF2043:  Uncharacterized conserved protein (DUF2043);  InterPro: IPR018610 This entry consists of uncharacterised proteins of unknown function. They contain three conserved cysteines and a {CP}{y/l}{HG} motif. 
Probab=43.77  E-value=11  Score=26.50  Aligned_cols=21  Identities=43%  Similarity=0.817  Sum_probs=16.8

Q ss_pred             CeEEEEeecCCEeeeCCCCCC
Q 045565           32 TRVRFMCSFGGKILPRPHDNQ   52 (83)
Q Consensus        32 ~kvKllCSyGGrIlPRp~Dg~   52 (83)
                      -+-++-|=|-|+|+||-..|.
T Consensus        84 RrD~~kCPfHG~IIpRD~~G~  104 (110)
T PF09740_consen   84 RRDRKKCPFHGKIIPRDDEGN  104 (110)
T ss_pred             ccCcccCCCCCcccCCCCCCC
Confidence            356778999999999976654


No 46 
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2. hPLIC-1 and hPLIC-2 (human homologs of the yeast ubiquitin-like Dsk2 protein)  are type2 UBL's (ubiquitin-like) proteins that are thought to serve as adaptors that link the ubiquitination machinery to the proteasome.  The hPLIC's have an N-terminal UBL domain that binds the S5a subunit of the proteasome and a C-terminal UBA (ubiquitin-associated) domain that binds a ubiquitylated protein.
Probab=43.18  E-value=57  Score=19.33  Aligned_cols=26  Identities=8%  Similarity=0.091  Sum_probs=21.4

Q ss_pred             cCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           57 GGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        57 GGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .|.+ .|.|+.+.+-.+|.+++++..|
T Consensus         9 ~g~~-~l~v~~~~TV~~lK~~I~~~~~   34 (71)
T cd01808           9 KDKE-EIEIAEDASVKDFKEAVSKKFK   34 (71)
T ss_pred             CCCE-EEEECCCChHHHHHHHHHHHhC
Confidence            4554 7899999999999999987654


No 47 
>cd01793 Fubi Fubi ubiquitin-like protein. Fubi is a ubiquitin-like protein encoded by the fau gene which has an  N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30.  Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.
Probab=43.06  E-value=73  Score=19.08  Aligned_cols=27  Identities=22%  Similarity=0.342  Sum_probs=23.1

Q ss_pred             cCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           57 GGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        57 GGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +++|..+.|+.+.+..+|.+++++.-|
T Consensus         7 ~~~~~~l~v~~~~tV~~lK~~i~~~~g   33 (74)
T cd01793           7 AQNTHTLEVTGQETVSDIKAHVAGLEG   33 (74)
T ss_pred             CCCEEEEEECCcCcHHHHHHHHHhhhC
Confidence            457889999999999999999987643


No 48 
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins. MoaD family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor of a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), that contains the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase, the second major step in Moco biosynthesis. MPT synthase consists of a large (MoeE) and small (MoaD) subunit. The small subunit  is inserted into the lare subunit to form the active site.  The small subunit, which is structurally similar to ubiquitin, contains a C-terminal thiocarboxylated glycine residue that serves as a sulfur donor for the synthesis of the MPT dithiolene group.
Probab=42.01  E-value=38  Score=20.02  Aligned_cols=26  Identities=23%  Similarity=0.314  Sum_probs=20.4

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhh
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKL   81 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l   81 (83)
                      +|-+..-+.++.+++..||+++|.+.
T Consensus        13 ~g~~~~~~~~~~~~tv~~ll~~l~~~   38 (80)
T cd00754          13 AGKDEEELELPEGATVGELLDALEAR   38 (80)
T ss_pred             hCCceEEEECCCCCcHHHHHHHHHHH
Confidence            35555667888899999999999764


No 49 
>cd06552 ASCH_yqfb_like ASC-1 homology domain, subfamily similar to Escherichia coli Yqfb. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=41.99  E-value=27  Score=21.95  Aligned_cols=51  Identities=20%  Similarity=0.200  Sum_probs=32.5

Q ss_pred             CeEEEEeecCCEeeeCCCCCCeEEe----cCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           32 TRVRFMCSFGGKILPRPHDNQLRYV----GGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        32 ~kvKllCSyGGrIlPRp~Dg~LrYv----GGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++-..=|+.+.+-.|.|.|--.-|.    -|..+|.+|.+ ++|.+|-...++.+|
T Consensus        15 G~Kt~t~R~~~~~~~~~Gd~~~~~~~~~~~~~~~v~~V~~-~~~~~l~~~~A~~eG   69 (100)
T cd06552          15 GKKTATIRDGGESHLKPGDVVEVHTGERIFGEAEITSVEE-KTLGELTDEDARQEG   69 (100)
T ss_pred             CCCEEEEeCCCccCCCCCCEEEEEECCEEEEEEEEEEEEE-EEhhhCCHHHHHhcC
Confidence            3334445554555566665544443    46778888877 888888887777665


No 50 
>PF11543 UN_NPL4:  Nuclear pore localisation protein NPL4;  InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway.  Npl4 has a N-terminal ubiquitin-like domain which has within its structure a beta-grasp fold with a helical insert []. This entry represents the ubiquitin-like domain.; PDB: 2PJH_A 1WF9_A.
Probab=40.95  E-value=32  Score=21.95  Aligned_cols=21  Identities=38%  Similarity=0.403  Sum_probs=16.6

Q ss_pred             EEEcCCCChHHHHHHHHhhhC
Q 045565           63 VAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        63 isV~R~isf~eL~~Kls~l~G   83 (83)
                      |.|+.+.++.+|.+|+.+.++
T Consensus        18 ie~~~~~t~~~L~~kI~~~l~   38 (80)
T PF11543_consen   18 IEVSPSSTLSDLKEKISEQLS   38 (80)
T ss_dssp             EEE-TTSBHHHHHHHHHHHS-
T ss_pred             EEcCCcccHHHHHHHHHHHcC
Confidence            378999999999999998653


No 51 
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=40.38  E-value=38  Score=29.35  Aligned_cols=28  Identities=29%  Similarity=0.477  Sum_probs=23.5

Q ss_pred             EecCceeEEEEcCCCChHHHHHHHHhhh
Q 045565           55 YVGGDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        55 YvGGeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      |.+|+.-|..++..++|.+|.+.+..+|
T Consensus        21 ~y~g~i~i~~~~p~~~~e~~~~~vrd~c   48 (593)
T KOG0695|consen   21 HYGGDIFITSVDPATTFEELCEEVRDMC   48 (593)
T ss_pred             eecCcEEEEeccCcccHHHHHHHHHHHH
Confidence            4455556889999999999999999888


No 52 
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the N-terminal ACT domain of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=40.31  E-value=68  Score=21.17  Aligned_cols=39  Identities=23%  Similarity=0.316  Sum_probs=27.5

Q ss_pred             cCCEeeeC--CCCCCeEEecCceeEEEEcCC----CChHHHHHHHHhhh
Q 045565           40 FGGKILPR--PHDNQLRYVGGDTRIVAVHRS----STFSTLLTKLSKLA   82 (83)
Q Consensus        40 yGGrIlPR--p~Dg~LrYvGGeTRIisV~R~----isf~eL~~Kls~l~   82 (83)
                      ||=.|.--  ..||+-+||=    .-.|+|.    +.|.-|..+|.++|
T Consensus        24 fGl~i~rgd~sTDGkWCyiv----~wVv~~~~~~~~rW~lLK~RL~~~C   68 (69)
T cd04894          24 FGLNITRGDDSTDGRWCYIV----FWVVPRPPSIKVRWDLLKNRLMSAC   68 (69)
T ss_pred             hceEEEecccccCCcEEEEE----EEEecCCCCCcccHHHHHHHHHhcC
Confidence            44444432  5899999972    2234665    78999999999987


No 53 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=36.83  E-value=56  Score=21.75  Aligned_cols=24  Identities=17%  Similarity=0.398  Sum_probs=20.0

Q ss_pred             ceeEEEEcCC--CChHHHHHHHHhhh
Q 045565           59 DTRIVAVHRS--STFSTLLTKLSKLA   82 (83)
Q Consensus        59 eTRIisV~R~--isf~eL~~Kls~l~   82 (83)
                      |-|-+++++.  ++|.+|..++.++|
T Consensus        15 EIRRf~l~~~~~~s~~~L~~~V~~~f   40 (87)
T cd06402          15 EIRRFAIDEDVSTSYEYLVEKVAAVF   40 (87)
T ss_pred             ceEEEEecCCCCcCHHHHHHHHHHHc
Confidence            6688888555  69999999999987


No 54 
>smart00314 RA Ras association (RalGDS/AF-6) domain. RasGTP effectors (in cases of AF6, canoe and RalGDS); putative RasGTP effectors in other cases. Kalhammer et al. have shown that not all RA domains bind RasGTP. Predicted structure similar to that determined, and that of the RasGTP-binding domain of Raf kinase. Predicted RA domains in PLC210 and nore1 found to bind RasGTP. Included outliers (Grb7, Grb14, adenylyl cyclases etc.)
Probab=36.22  E-value=84  Score=19.24  Aligned_cols=27  Identities=19%  Similarity=0.272  Sum_probs=23.2

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhh
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      .++..+.|.|.++.+-+|++..+.+-.
T Consensus        13 ~~~~~kti~v~~~tTa~~Vi~~~l~k~   39 (90)
T smart00314       13 PGGTYKTLRVSSRTTARDVIQQLLEKF   39 (90)
T ss_pred             CCCcEEEEEECCCCCHHHHHHHHHHHh
Confidence            367799999999999999999887654


No 55 
>PF13889 Chromosome_seg:  Chromosome segregation during meiosis
Probab=35.19  E-value=56  Score=20.52  Aligned_cols=29  Identities=34%  Similarity=0.666  Sum_probs=22.1

Q ss_pred             eEEEEeecCCEeeeCCCCCCeEEecCceeEEEEcCCCCh
Q 045565           33 RVRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHRSSTF   71 (83)
Q Consensus        33 kvKllCSyGGrIlPRp~Dg~LrYvGGeTRIisV~R~isf   71 (83)
                      .++|+|+-.|||          |.=++-|||-..|....
T Consensus         8 HLrf~~~~~gr~----------YLh~dIRvvF~~r~~d~   36 (56)
T PF13889_consen    8 HLRFCCPRSGRF----------YLHTDIRVVFARRSPDS   36 (56)
T ss_pred             EEEEecCCCCcE----------EEECCeEEEEeccCCCC
Confidence            479999988887          77778888877776543


No 56 
>TIGR00165 S18 ribosomal protein S18. This ribosomal small subunit protein is found in all eubacteria so far, as well as in chloroplasts. YER050C from Saccharomyces cerevisiae and a related protein from Caenorhabditis elegans appear to be homologous and may represent mitochondrial forms. The trusted cutoff is set high enough that these two candidate S18 proteins are not categorized automatically.
Probab=34.23  E-value=15  Score=23.64  Aligned_cols=16  Identities=44%  Similarity=0.810  Sum_probs=11.6

Q ss_pred             EEEeecCCEeeeCCCCC
Q 045565           35 RFMCSFGGKILPRPHDN   51 (83)
Q Consensus        35 KllCSyGGrIlPRp~Dg   51 (83)
                      +|+.. .|+|+||.-.|
T Consensus        28 ~Fis~-~GkIlpRriTg   43 (70)
T TIGR00165        28 KFISE-RGKILPRRITG   43 (70)
T ss_pred             HhcCC-CCeEcCCccCC
Confidence            45554 59999997665


No 57 
>PF04663 Phenol_monoox:  Phenol hydroxylase conserved region;  InterPro: IPR006756 Under aerobic conditions, phenol is usually hydroxylated to catechol and degraded via the meta or ortho pathways. Two types of phenol hydroxylase are known: one is a multi-component enzyme the other is a single-component monooxygenase. This signature is found in both types of enzymes [, ].; PDB: 3U52_F 2INN_F 2INP_E.
Probab=34.14  E-value=31  Score=22.39  Aligned_cols=31  Identities=29%  Similarity=0.503  Sum_probs=22.5

Q ss_pred             CCCCeEEecCcee-------EEEEcCCCChHHHHHHHH
Q 045565           49 HDNQLRYVGGDTR-------IVAVHRSSTFSTLLTKLS   79 (83)
Q Consensus        49 ~Dg~LrYvGGeTR-------IisV~R~isf~eL~~Kls   79 (83)
                      ++++|=|||=|-+       -+-|+.+.+|.+|+++.-
T Consensus         9 ~g~qLlYigWd~HllFcap~~~plpP~mpFg~l~~~vl   46 (67)
T PF04663_consen    9 HGNQLLYIGWDDHLLFCAPFAFPLPPDMPFGALVEQVL   46 (67)
T ss_dssp             TT-EEEEEE-TT-TTS-S-EEEEE-TTSBHHHHHHHTH
T ss_pred             CCceEEEEEecCCeeeecceeecCCCCCcHHHHHHHhh
Confidence            5678899998865       578999999999998754


No 58 
>smart00295 B41 Band 4.1 homologues. Also known as ezrin/radixin/moesin (ERM) protein domains. Present in myosins, ezrin, radixin, moesin, protein tyrosine phosphatases. Plasma membrane-binding domain. These proteins play structural and regulatory roles in the assembly and stabilization of specialized plasmamembrane domains. Some PDZ domain containing proteins bind one or more of this family. Now includes JAKs.
Probab=33.80  E-value=81  Score=21.18  Aligned_cols=32  Identities=25%  Similarity=0.326  Sum_probs=27.4

Q ss_pred             CeEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           52 QLRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        52 ~LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++...+|.++-+.|+.+++-.|++..+.+.+|
T Consensus         7 ~V~l~dg~~~~~~~~~~~t~~ev~~~v~~~~~   38 (207)
T smart00295        7 KVYLLDGTTLEFEVDSSTTAEELLETVCRKLG   38 (207)
T ss_pred             EEEecCCCEEEEEECCCCCHHHHHHHHHHHhC
Confidence            34566788999999999999999999988765


No 59 
>PF09379 FERM_N:  FERM N-terminal domain ;  InterPro: IPR018979  This domain is the N-terminal ubiquitin-like structural domain of the FERM domain.  The FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane []. FERM domains are found in a number of cytoskeletal-associated proteins that associate with various proteins at the interface between the plasma membrane and the cytoskeleton. The FERM domain is located at the N terminus of the majority of FERM-containing proteins [, ], which includes:    Band 4.1, which links the spectrin-actin cytoskeleton of erythrocytes to the plasma membrane. Ezrin, a component of the undercoat of the microvilli plasma membrane. Moesin, which is probably involved in binding major cytoskeletal structures to the plasma membrane. Radixin, which is involved in the binding of the barbed end of actin filaments to the plasma membrane in the undercoat of the cell- to-cell adherens junction. Talin, a cytoskeletal protein concentrated in regions of cell-substratum contact and, in lymphocytes, of cell-cell contacts. Filopodin, a slime mold protein that binds actin and which is involved in the control of cell motility and chemotaxis. Merlin (or schwannomin). Protein NBL4. Unconventional myosins X, VIIa and XV, which are mutated in congenital deafness. Focal-adhesion kinases (FAKs), cytoplasmic protein tyrosine kinases involved in signalling through integrins. Janus tyrosine kinases (JAKs), cytoplasmic tyrosine kinases that are non-covalently associated with the cytoplasmic tails of receptors for cytokines or polypeptidic hormones. Non-receptor tyrosine-protein kinase TYK2. Protein-tyrosine phosphatases PTPN3 and PTPN4, enzyme that appear to act at junctions between the membrane and the cytoskeleton. Protein-tyrosine phosphatases PTPN14 and PTP-D1, PTP-RL10 and PTP2E.  Caenorhabditis elegans protein phosphatase ptp-1.   Ezrin, moesin, and radixin are highly related proteins (ERM protein family), but the other proteins in which the FERM domain is found do not share any region of similarity outside of this domain. ERM proteins are made of three domains, the FERM domain, a central helical domain and a C-terminal tail domain, which binds F-actin. The amino-acid sequence of the FERM domain is highly conserved among ERM proteins and is responsible for membrane association by direct binding to the cytoplasmic domain or tail of integral membrane proteins. ERM proteins are regulated by an intramolecular association of the FERM and C-terminal tail domains that masks their binding sites for other molecules. For cytoskeleton-membrane cross-linking, the dormant molecules becomes activated and the FERM domain attaches to the membrane by binding specific membrane proteins, while the last 34 residues of the tail bind actin filaments. Aside from binding to membranes, the activated FERM domain of ERM proteins can also bind the guanine nucleotide dissociation inhibitor of Rho GTPase (RhoDGI), which suggests that in addition to functioning as a cross-linker, ERM proteins may influence Rho signalling pathways. The crystal structure of the FERM domain reveals that it is composed of three structural modules (F1, F2, and F3) that together form a compact clover-shaped structure []. The FERM domain has also been called the amino-terminal domain, the 30kDa domain, 4.1N30, the membrane-cytoskeletal-linking domain, the ERM-like domain, the ezrin-like domain of the band 4.1 superfamily, the conserved N-terminal region, and the membrane attachment domain [].; PDB: 1EF1_B 1SGH_A 1E5W_A 2KC2_A 2KMA_A 3IVF_A 1H4R_B 3U8Z_A 1ISN_A 3BIN_A ....
Probab=33.33  E-value=67  Score=18.99  Aligned_cols=26  Identities=23%  Similarity=0.282  Sum_probs=22.2

Q ss_pred             cCceeEEEEcCCCChHHHHHHHHhhh
Q 045565           57 GGDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        57 GGeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      -|.++.+.|+++.+-.+|..++.+..
T Consensus         5 D~~~~~~~v~~~~t~~~l~~~v~~~l   30 (80)
T PF09379_consen    5 DGTTKTFEVDPKTTGQDLLEQVCDKL   30 (80)
T ss_dssp             SEEEEEEEEETTSBHHHHHHHHHHHH
T ss_pred             CCCcEEEEEcCCCcHHHHHHHHHHHc
Confidence            46789999999999999999887654


No 60 
>PRK06437 hypothetical protein; Provisional
Probab=33.13  E-value=71  Score=19.48  Aligned_cols=26  Identities=15%  Similarity=0.356  Sum_probs=22.1

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHH
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKL   78 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kl   78 (83)
                      .+-.|+.++-+.++.+.+.++|++.|
T Consensus         5 ~~v~g~~~~~~~i~~~~tv~dLL~~L   30 (67)
T PRK06437          5 IRVKGHINKTIEIDHELTVNDIIKDL   30 (67)
T ss_pred             EEecCCcceEEEcCCCCcHHHHHHHc
Confidence            44558899999999999999999876


No 61 
>PF11784 DUF3320:  Protein of unknown function (DUF3320);  InterPro: IPR021754  This family is conserved in Proteobacteria and Chlorobi families. Many members are annotated as being putative DNA helicase-related proteins. 
Probab=32.09  E-value=13  Score=22.13  Aligned_cols=23  Identities=22%  Similarity=0.294  Sum_probs=19.1

Q ss_pred             eEEEEcCCCChHHHHHHHHhhhC
Q 045565           61 RIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        61 RIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .||.+.-.|+..+|.+|+.+.+|
T Consensus        19 ~Iv~~EgPI~~~~L~~Ri~~a~G   41 (52)
T PF11784_consen   19 QIVEVEGPIHEDELARRIARAWG   41 (52)
T ss_pred             HHHHHcCCccHHHHHHHHHHHcC
Confidence            35666778999999999999887


No 62 
>PF12436 USP7_ICP0_bdg:  ICP0-binding domain of Ubiquitin-specific protease 7;  InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found in proteins of the peptidase C19 family, which contains contains ubiquitinyl hydrolases like ubiquitin-specific protease 7 (USP7). USP7 regulates the turnover of p53 [].; PDB: 2KVR_A 2YLM_A.
Probab=31.85  E-value=47  Score=24.87  Aligned_cols=32  Identities=34%  Similarity=0.614  Sum_probs=26.1

Q ss_pred             CCCCCeEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           48 PHDNQLRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        48 p~Dg~LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      |...+|+|+|-    +.|+++.+.++|...+.+++|
T Consensus        78 p~~q~L~~iGh----~~v~~~~~v~~l~~~i~~~~g  109 (249)
T PF12436_consen   78 PETQTLRYIGH----VYVPKNDKVSELVPLINERAG  109 (249)
T ss_dssp             TTTTEEEEEEE----EEEETT-BGGGTHHHHHHHHT
T ss_pred             CCCCEEEEEeE----EEECCCCCHHHHHHHHHHHcC
Confidence            46778999994    567999999999999998876


No 63 
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of  Np95 and NIRF. NIRF_N    This CD represents the amino-terminal ubiquitin-like domain of a family of nuclear proteins that includes Np95 and NIRF (Np95/ICBP90-like RING finger) protein.  Both Np95 and NIRF have a domain architecture consisting of a ubiquitin-like domain, a PHD finger, a YDG/SRA domain, Rb-binding motifs and a RING finger domain. Both Np95 and NIRF are ubiquitin ligases that ubiquitinate PCNP (PEST-containing nuclear proteins). While Np95 is capable of binding histones, NIRF is involved in cell cycle regulation.
Probab=31.06  E-value=1.1e+02  Score=19.06  Aligned_cols=30  Identities=27%  Similarity=0.400  Sum_probs=22.7

Q ss_pred             EEecCce-eEEE-EcCCCChHHHHHHHHhhhC
Q 045565           54 RYVGGDT-RIVA-VHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        54 rYvGGeT-RIis-V~R~isf~eL~~Kls~l~G   83 (83)
                      +-..|.+ .-+. |+.+.+..+|.+++++..|
T Consensus         6 k~~~G~~~~~l~~v~~~~TV~~lK~~i~~~~g   37 (78)
T cd01797           6 RTMDGKETRTVDSLSRLTKVEELREKIQELFN   37 (78)
T ss_pred             EcCCCCEEEEeeccCCcCcHHHHHHHHHHHhC
Confidence            4456776 3464 7889999999999988654


No 64 
>PF04726 Microvir_J:  Microvirus J protein;  InterPro: IPR006815 This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic C terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions [].; GO: 0003677 DNA binding, 0019073 viral DNA genome packaging, 0019028 viral capsid; PDB: 1M06_J 1GFF_3 1RB8_J 2BPA_3.
Probab=30.37  E-value=24  Score=19.08  Aligned_cols=9  Identities=56%  Similarity=1.036  Sum_probs=3.3

Q ss_pred             CCeEEecCc
Q 045565           51 NQLRYVGGD   59 (83)
Q Consensus        51 g~LrYvGGe   59 (83)
                      -.|.||||.
T Consensus        14 arlwyvgg~   22 (24)
T PF04726_consen   14 ARLWYVGGT   22 (24)
T ss_dssp             S----SSS-
T ss_pred             eEEEEecce
Confidence            369999995


No 65 
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=30.01  E-value=73  Score=22.69  Aligned_cols=43  Identities=21%  Similarity=0.304  Sum_probs=30.4

Q ss_pred             CCEeeeCCCCCCeEEe------------------cCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           41 GGKILPRPHDNQLRYV------------------GGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        41 GGrIlPRp~Dg~LrYv------------------GGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      +|+|..-..|+++.||                  .|.+.++.-+..+|+.|+.+.+++..|
T Consensus       154 ~~~~~~~~g~~~~~~v~~~Dva~~~~~~l~~~~~~~~~~~l~g~~~~s~~eia~~l~~~~g  214 (285)
T TIGR03649       154 ENKIYSATGDGKIPFVSADDIARVAYRALTDKVAPNTDYVVLGPELLTYDDVAEILSRVLG  214 (285)
T ss_pred             CCeEEecCCCCccCcccHHHHHHHHHHHhcCCCcCCCeEEeeCCccCCHHHHHHHHHHHhC
Confidence            3555544456666654                  245566777889999999999998876


No 66 
>cd01791 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also known as HUB1) is a ubiquitin-like modifier that is both widely expressed and highly phylogenetically conserved.  At the C-terminal end of the ubiquitin-like fold of UBL5 is a di-tyrosine motif followed by a single variable residue instead of the characteristic di-glycine found in all other ubiquitin-like modifiers.  ULB5 interacts with a cyclin-like kinase called CLK4 but not with other cyclin-like kinase family members.
Probab=30.00  E-value=1.1e+02  Score=18.87  Aligned_cols=25  Identities=16%  Similarity=0.181  Sum_probs=21.5

Q ss_pred             CceeEEEEcCCCChHHHHHHHHhhh
Q 045565           58 GDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        58 GeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      |.+..+.|+.+.+..+|.+++++..
T Consensus        11 Gk~~~~~v~~~~TV~~LK~~I~~~~   35 (73)
T cd01791          11 GKKVRVKCNPDDTIGDLKKLIAAQT   35 (73)
T ss_pred             CCEEEEEeCCCCcHHHHHHHHHHHh
Confidence            6777789999999999999998754


No 67 
>CHL00077 rps18 ribosomal protein S18
Probab=29.78  E-value=20  Score=24.22  Aligned_cols=16  Identities=44%  Similarity=0.704  Sum_probs=12.4

Q ss_pred             EEEeecCCEeeeCCCCC
Q 045565           35 RFMCSFGGKILPRPHDN   51 (83)
Q Consensus        35 KllCSyGGrIlPRp~Dg   51 (83)
                      +|++. .|+|+||--.|
T Consensus        38 ~Fis~-~GkIlpRriTG   53 (86)
T CHL00077         38 RFISE-QGKILSRRVTR   53 (86)
T ss_pred             HhcCC-CCeEcCcccCC
Confidence            46665 89999997665


No 68 
>PF00763 THF_DHG_CYH:  Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain;  InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF). Various reactions generate one-carbon derivatives of THF, which can be interconverted between different oxidation states by methylene-THF dehydrogenase (1.5.1.5 from EC), methenyl-THF cyclohydrolase (3.5.4.9 from EC) and formyl-THF synthetase (6.3.4.3 from EC) [, ]. The dehydrogenase and cyclohydrolase activities are expressed by a variety of multifunctional enzymes, including the tri-functional eukaryotic C1-tetrahydrofolate synthase []; a bifunctional eukaryotic mitochondrial protein; and the bifunctional Escherichia coli folD protein [, ]. Methylene-tetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclo-hydrolase share an overlapping active site [], and as such are usually located together in proteins, acting in tandem on the carbon-nitrogen bonds of substrates other than peptide bonds. This entry represents the N-terminal catalytic domain of these enzymes. ; GO: 0003824 catalytic activity, 0004488 methylenetetrahydrofolate dehydrogenase (NADP+) activity, 0009396 folic acid-containing compound biosynthetic process, 0055114 oxidation-reduction process; PDB: 2C2X_B 2C2Y_A 1EDZ_A 1EE9_A 4A26_B 3NGL_C 3NGX_A 1B0A_A 1DIA_A 1A4I_B ....
Probab=29.11  E-value=82  Score=21.00  Aligned_cols=27  Identities=19%  Similarity=0.297  Sum_probs=22.2

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhhh
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      +|-+++++.++.+++-.+|.+.+.++.
T Consensus        57 ~Gi~~~~~~l~~~~~~~el~~~i~~lN   83 (117)
T PF00763_consen   57 LGIEFELIELPEDISEEELLELIEKLN   83 (117)
T ss_dssp             HT-EEEEEEE-TTSSHHHHHHHHHHHH
T ss_pred             cCCceEEEECCCCcCHHHHHHHHHHHh
Confidence            488999999999999999999988763


No 69 
>COG0424 Maf Nucleotide-binding protein implicated in inhibition of septum formation [Cell division and chromosome partitioning]
Probab=28.79  E-value=40  Score=25.35  Aligned_cols=15  Identities=33%  Similarity=0.775  Sum_probs=13.2

Q ss_pred             EeecCCEeeeCCCCC
Q 045565           37 MCSFGGKILPRPHDN   51 (83)
Q Consensus        37 lCSyGGrIlPRp~Dg   51 (83)
                      +|..||||++.|.|-
T Consensus        73 vv~ldgrilgKP~~~   87 (193)
T COG0424          73 VVVLDGRILGKPKDE   87 (193)
T ss_pred             EEEECCEEecCCCCH
Confidence            678999999999884


No 70 
>PF00614 PLDc:  Phospholipase D Active site motif;  InterPro: IPR001736 Phosphatidylcholine-hydrolysing phospholipase D (PLD) isoforms are activated by ADP-ribosylation factors (ARFs). PLD produces phosphatidic acid from phosphatidylcholine, which may be essential for the formation of certain types of transport vesicles or may be constitutive vesicular transport to signal transduction pathways. PC-hydrolysing PLD is a homologue of cardiolipin synthase, phosphatidylserine synthase, bacterial PLDs, and viral proteins. Each of these appears to possess a domain duplication which is apparent by the presence of two motifs containing well-conserved histidine, lysine, and/or asparagine residues which may contribute to the active site aspartic acid. An Escherichia coli endonuclease (nuc) and similar proteins appear to be PLD homologues but possess only one of these motifs [, , , ].; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 3HSI_C.
Probab=28.37  E-value=35  Score=18.27  Aligned_cols=11  Identities=36%  Similarity=0.878  Sum_probs=7.9

Q ss_pred             CCCCeEEecCc
Q 045565           49 HDNQLRYVGGD   59 (83)
Q Consensus        49 ~Dg~LrYvGGe   59 (83)
                      -|+++.||||-
T Consensus        12 vD~~~a~vGg~   22 (28)
T PF00614_consen   12 VDDRVAFVGGA   22 (28)
T ss_dssp             ETTTEEEEE--
T ss_pred             EcCCEEEECce
Confidence            58889999984


No 71 
>cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain. N-terminal NMNAT (Nicotinamide/nicotinate mononucleotide adenylyltransferase) domain of a novel bifunctional enzyme endowed with NMN adenylyltransferase and Nudix hydrolase activities.  This domain is highly homologous to the archeal NMN adenyltransferase that catalyzes NAD synthesis from NMN and ATP.  NMNAT is an essential enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway.  The C-terminal domain of this enzyme shares homology with the archaeal ADP-ribose pyrophosphatase, a member of the 'Nudix' hydrolase family.
Probab=28.30  E-value=6.7  Score=28.28  Aligned_cols=16  Identities=25%  Similarity=0.505  Sum_probs=13.2

Q ss_pred             ecCCEeeeCCCCCCeEE
Q 045565           39 SFGGKILPRPHDNQLRY   55 (83)
Q Consensus        39 SyGGrIlPRp~Dg~LrY   55 (83)
                      =|||++.| +|.|.|..
T Consensus         3 l~~GrF~P-~H~GHl~~   18 (181)
T cd02168           3 VYIGRFQP-FHNGHLAV   18 (181)
T ss_pred             EEeeccCC-CCHHHHHH
Confidence            48999999 89988754


No 72 
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional
Probab=26.43  E-value=7.3  Score=27.90  Aligned_cols=17  Identities=29%  Similarity=0.538  Sum_probs=13.6

Q ss_pred             ecCCEeeeCCCCCCeEEe
Q 045565           39 SFGGKILPRPHDNQLRYV   56 (83)
Q Consensus        39 SyGGrIlPRp~Dg~LrYv   56 (83)
                      =|||++.| +|.|.|.++
T Consensus         4 l~~G~F~P-~H~GHl~~i   20 (174)
T PRK01153          4 LFIGRFQP-FHKGHLEVI   20 (174)
T ss_pred             EEeeccCC-CCHHHHHHH
Confidence            48999999 888877554


No 73 
>TIGR00601 rad23 UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.18  E-value=1.2e+02  Score=24.75  Aligned_cols=31  Identities=13%  Similarity=0.182  Sum_probs=26.9

Q ss_pred             eEEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           53 LRYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        53 LrYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      ++...|++..|.|+.+.+..+|.+|+.+..|
T Consensus         5 VKtl~g~~~~IeV~~~~TV~dLK~kI~~~~g   35 (378)
T TIGR00601         5 FKTLQQQKFKIDMEPDETVKELKEKIEAEQG   35 (378)
T ss_pred             EEeCCCCEEEEEeCCcChHHHHHHHHHHhhC
Confidence            5667899999999999999999999987653


No 74 
>PF09992 DUF2233:  Predicted periplasmic protein (DUF2233);  InterPro: IPR018711 This entry contains proteins that catalyze the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides, this is achieved by removing GlcNAc residues from GlcNAc-alpha-P-mannose moieties, which are formed in the first step.; PDB: 3OHG_A.
Probab=24.60  E-value=1.9e+02  Score=19.47  Aligned_cols=42  Identities=26%  Similarity=0.380  Sum_probs=22.9

Q ss_pred             cCCEeeeCCCCCC--------eEE-ecCceeEEEEc----CCCChHHHHHHHHhh
Q 045565           40 FGGKILPRPHDNQ--------LRY-VGGDTRIVAVH----RSSTFSTLLTKLSKL   81 (83)
Q Consensus        40 yGGrIlPRp~Dg~--------LrY-vGGeTRIisV~----R~isf~eL~~Kls~l   81 (83)
                      .+|++.+...+.+        +-| -.|+--++.|+    ..+++.||.+-|.+|
T Consensus        74 ~nG~~~~~~~~~~~~~~~RtaiG~~~~g~l~l~~vdg~~~~g~tl~ela~~l~~l  128 (170)
T PF09992_consen   74 KNGKIVPNFSDEGWGRHPRTAIGVTADGKLLLIVVDGRQSAGMTLDELAQLLKSL  128 (170)
T ss_dssp             ETTEE----TTSGGSSB-EEEEEE-TTSEEEEEEE----S--B-HHHHHHHHHHH
T ss_pred             ECCEEccCcccCccccCCEEEEEEeCCCcEEEEEEcCCcCCCCCHHHHHHHHHHc
Confidence            5888887766653        223 24555666777    689999999877664


No 75 
>PF05678 VQ:  VQ motif;  InterPro: IPR008889 This short motif is found in a variety of plant proteins. These proteins vary greatly in length and are mostly composed of low complexity regions. They all conserve a short motif FXhVQChTG, where X is any amino acid and h is a hydrophobic amino acid. The function of this motif is uncertain, however one protein in this family has been found to bind the SigA sigma factor Q9LDH1 from SWISSPROT. It would seem plausible that this motif is needed for this activity and that this whole family might be involved in modulating plastid sigma factors.
Probab=24.43  E-value=54  Score=18.17  Aligned_cols=20  Identities=20%  Similarity=0.471  Sum_probs=15.0

Q ss_pred             ceeEEEEcCCCChHHHHHHHH
Q 045565           59 DTRIVAVHRSSTFSTLLTKLS   79 (83)
Q Consensus        59 eTRIisV~R~isf~eL~~Kls   79 (83)
                      .|++|.++.+ .|.+|+++|.
T Consensus         4 ~p~vi~~d~~-~Fr~lVQ~LT   23 (31)
T PF05678_consen    4 PPTVIHTDPS-NFRALVQRLT   23 (31)
T ss_pred             CCEEEEeCHH-HHHHHHHHhH
Confidence            3667776654 8999999985


No 76 
>KOG1722 consensus 60s ribosomal protein L24 [Translation, ribosomal structure and biogenesis]
Probab=24.06  E-value=1.3e+02  Score=22.49  Aligned_cols=38  Identities=37%  Similarity=0.734  Sum_probs=27.0

Q ss_pred             EeecCC-EeeeCCCCCCeEEecCceeEEEE--------------cCCCChHHHHHH
Q 045565           37 MCSFGG-KILPRPHDNQLRYVGGDTRIVAV--------------HRSSTFSTLLTK   77 (83)
Q Consensus        37 lCSyGG-rIlPRp~Dg~LrYvGGeTRIisV--------------~R~isf~eL~~K   77 (83)
                      +|||-| +|.|  . .--+||-||..|..+              ||.|.|.-|-.+
T Consensus         5 lCsFSG~KIyP--G-~G~r~vR~D~Kvf~Fln~Kc~~~f~~rrnPr~l~WTvLyR~   57 (155)
T KOG1722|consen    5 LCSFSGYKIYP--G-HGRRFVRGDGKVFRFLNSKCESLFLQRRNPRRLAWTVLYRK   57 (155)
T ss_pred             EeeccCceecC--C-CceeEEecCCeeeeehhhhhHHHHHhccChhhhhHHHHHHH
Confidence            799977 6777  2 236788898888754              455777777654


No 77 
>PF07929 PRiA4_ORF3:  Plasmid pRiA4b ORF-3-like protein;  InterPro: IPR012912 Members of this family are similar to the protein product of ORF-3 (Q44206 from SWISSPROT) found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumourigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process []. Other proteins found in this family are annotated as being putative TnpR resolvases (Q9LCU7 from SWISSPROT, Q50439 from SWISSPROT), but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor (Q7UEI4 from SWISSPROT) and in fact carries a LexA DNA binding domain (IPR006199 from INTERPRO), but no references were found to expand on this. ; PDB: 2I1S_A.
Probab=23.64  E-value=1.1e+02  Score=21.24  Aligned_cols=24  Identities=21%  Similarity=0.195  Sum_probs=18.7

Q ss_pred             eeEEEEcCCCChHHHHHHHHhhhC
Q 045565           60 TRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        60 TRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .|-|.|+-+++|.+|-.-+-...|
T Consensus        19 wRri~Vp~~~tl~~Lh~~Iq~afg   42 (179)
T PF07929_consen   19 WRRIEVPADITLADLHEVIQAAFG   42 (179)
T ss_dssp             EEEEEEETT-BHHHHHHHHHHHTT
T ss_pred             EEEEEECCCCCHHHHHHHHHHHhC
Confidence            688999999999999877665543


No 78 
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=23.63  E-value=2.1e+02  Score=18.63  Aligned_cols=41  Identities=27%  Similarity=0.549  Sum_probs=28.8

Q ss_pred             EeecCCEeeeCCCCCCeEEecCceeEEE--------------EcCCCChHHHHHHHH
Q 045565           37 MCSFGGKILPRPHDNQLRYVGGDTRIVA--------------VHRSSTFSTLLTKLS   79 (83)
Q Consensus        37 lCSyGGrIlPRp~Dg~LrYvGGeTRIis--------------V~R~isf~eL~~Kls   79 (83)
                      .|||=|+.++ |..| +=||=+|-+|+-              .||.+.|...-.++.
T Consensus         5 ~CsFcG~~I~-PGtG-~m~Vr~Dg~v~~FcssKc~k~~~~~rnPRk~~WT~~~~~~~   59 (66)
T COG2075           5 VCSFCGKKIE-PGTG-IMYVRNDGKVLRFCSSKCEKLFKLGRNPRKLKWTKKYRKMH   59 (66)
T ss_pred             EecCcCCccC-CCce-EEEEecCCeEEEEechhHHHHHHccCCCccchhHHHHHHHH
Confidence            5999887766 3444 558999998885              467777777666553


No 79 
>PF02519 Auxin_inducible:  Auxin responsive protein;  InterPro: IPR003676 This family consists of the protein products of a gene cluster that encodes a group of auxin-regulated RNAs (small auxin up RNAs, SAURs) []. Proteins from this ARG7 auxin responsive genes family have no identified functional role [].
Probab=23.14  E-value=92  Score=20.83  Aligned_cols=36  Identities=31%  Similarity=0.422  Sum_probs=25.8

Q ss_pred             CCCCCeEEecCceeEEEEcCC----CChHHHHHHHHhhhC
Q 045565           48 PHDNQLRYVGGDTRIVAVHRS----STFSTLLTKLSKLAG   83 (83)
Q Consensus        48 p~Dg~LrYvGGeTRIisV~R~----isf~eL~~Kls~l~G   83 (83)
                      |...--=|||-+.|-..|+-.    --|.+|+.+-.+-+|
T Consensus        37 p~G~~~VyVG~~~~Rfvvp~~~L~hp~f~~LL~~aeeEfG   76 (100)
T PF02519_consen   37 PKGHFAVYVGEERRRFVVPVSYLNHPLFQELLEQAEEEFG   76 (100)
T ss_pred             CCCeEEEEeCccceEEEechHHcCchhHHHHHHHHhhhcC
Confidence            444456799998988888865    468888877766443


No 80 
>PF00788 RA:  Ras association (RalGDS/AF-6) domain;  InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals []. This factor stimulates the dissociation of GDP from the Ras-related RALA and RALB GTPases, which allows GTP binding and activation of the GTPases. It interacts and acts as an effector molecule for R-ras, K-Ras and Rap []. The domain is also present in a number of other proteins among them the sexual differentiation protein in yeast that is essential for mating and meiosis and yeast adenylate cyclase. These proteins contain repeated leucine-rich (LRR) segments.; GO: 0007165 signal transduction; PDB: 3EC8_A 2C5L_D 2BYF_A 2CS4_A 3KH0_A 2B3A_A 1RAX_A 2RGF_A 1WGR_A 1WXA_A ....
Probab=22.99  E-value=1.8e+02  Score=17.25  Aligned_cols=25  Identities=16%  Similarity=0.171  Sum_probs=21.6

Q ss_pred             ceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           59 DTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        59 eTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      .++.|.|+.+.+-.|++..+.+-+|
T Consensus        17 ~~k~i~v~~~tTa~evi~~~l~k~~   41 (93)
T PF00788_consen   17 TYKTIKVSSSTTAREVIEMALEKFG   41 (93)
T ss_dssp             SEEEEEEETTSBHHHHHHHHHHHTT
T ss_pred             cEEEEEECCCCCHHHHHHHHHHHhC
Confidence            4899999999999999998877553


No 81 
>PF07045 DUF1330:  Protein of unknown function (DUF1330);  InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
Probab=22.74  E-value=79  Score=18.83  Aligned_cols=19  Identities=26%  Similarity=0.518  Sum_probs=11.0

Q ss_pred             eecCCEeeeCCCCCCeEEec
Q 045565           38 CSFGGKILPRPHDNQLRYVG   57 (83)
Q Consensus        38 CSyGGrIlPRp~Dg~LrYvG   57 (83)
                      =.|||+++-| .+.....-|
T Consensus        16 ~~~GG~~l~~-~~~~~~leG   34 (65)
T PF07045_consen   16 EKYGGRVLAR-GGEPEVLEG   34 (65)
T ss_dssp             HHTT-EEEEE-CEEEEEEES
T ss_pred             HHcCCEEEEE-CCceeEEec
Confidence            3589999998 223344444


No 82 
>PF08856 DUF1826:  Protein of unknown function (DUF1826);  InterPro: IPR014955 These proteins are functionally uncharacterised. 
Probab=22.34  E-value=49  Score=24.48  Aligned_cols=17  Identities=29%  Similarity=0.876  Sum_probs=12.5

Q ss_pred             CeEEEEeecCC---EeeeCC
Q 045565           32 TRVRFMCSFGG---KILPRP   48 (83)
Q Consensus        32 ~kvKllCSyGG---rIlPRp   48 (83)
                      --+||+|.|.|   ..++..
T Consensus       112 vp~RLlcTY~G~GTewl~~~  131 (196)
T PF08856_consen  112 VPLRLLCTYRGPGTEWLPND  131 (196)
T ss_pred             cceEEEEEEecCCcEEccCc
Confidence            35899999988   455554


No 83 
>COG5470 Uncharacterized conserved protein [Function unknown]
Probab=22.27  E-value=87  Score=21.68  Aligned_cols=27  Identities=30%  Similarity=0.375  Sum_probs=16.9

Q ss_pred             eecCCEeeeCCCCCCeEEec--Cc-eeEEEEc
Q 045565           38 CSFGGKILPRPHDNQLRYVG--GD-TRIVAVH   66 (83)
Q Consensus        38 CSyGGrIlPRp~Dg~LrYvG--Ge-TRIisV~   66 (83)
                      =.||||.|-|-.+-  .=.=  .. ||+|.|.
T Consensus        30 ~~~Ggr~LvRGG~v--~~lEG~w~ptr~vviE   59 (96)
T COG5470          30 EKFGGRYLVRGGEV--ETLEGEWRPTRNVVIE   59 (96)
T ss_pred             HHhCCeeEeeCCCe--eeccCCCCcccEEEEE
Confidence            35999999975432  2222  44 7787763


No 84 
>PRK13600 putative ribosomal protein L7Ae-like; Provisional
Probab=21.95  E-value=1.5e+02  Score=19.51  Aligned_cols=24  Identities=8%  Similarity=0.122  Sum_probs=20.9

Q ss_pred             CceeEEEEcCCCChHHHHHHHHhhh
Q 045565           58 GDTRIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        58 GeTRIisV~R~isf~eL~~Kls~l~   82 (83)
                      |+.+.|-|.++++ ..++.+|-.+|
T Consensus        28 g~~~~v~iA~Da~-~~vv~~l~~lc   51 (84)
T PRK13600         28 DQVTSLIIAEDVE-VYLMTRVLSQI   51 (84)
T ss_pred             CCceEEEEeCCCC-HHHHHHHHHHH
Confidence            8889999999999 66888888887


No 85 
>PF14832 Tautomerase_3:  Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A.
Probab=21.94  E-value=1.2e+02  Score=21.37  Aligned_cols=28  Identities=25%  Similarity=0.312  Sum_probs=18.2

Q ss_pred             eEEecCcee-------EEEEcCCCChHHHHHHHHh
Q 045565           53 LRYVGGDTR-------IVAVHRSSTFSTLLTKLSK   80 (83)
Q Consensus        53 LrYvGGeTR-------IisV~R~isf~eL~~Kls~   80 (83)
                      --||||+.+       |-.+-|++.-.|..+++.+
T Consensus        50 ~~fvGG~~~~~fvrI~i~hiaR~~~~~e~~~~~~~   84 (136)
T PF14832_consen   50 DFFVGGKPRDNFVRIVIDHIARTGPDDEQRRRLLD   84 (136)
T ss_dssp             SEEETTEE-SSCEEEEEEEEEEST-SHHHHHHHHH
T ss_pred             CeEECCcCcCceEEEEEEEEeecCCCHHHHHHHHH
Confidence            689999977       3344577777777766654


No 86 
>PF01084 Ribosomal_S18:  Ribosomal protein S18;  InterPro: IPR001648 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Evidence suggests that, in prokaryotes, the peptidyl transferase reaction is performed by the large subunit 23S rRNA, whereas proteins probably have a greater role in eukaryotic ribosomes. Most of the proteins lie close to, or on the surface of, the 30S subunit, arranged peripherally around the rRNA []. The small subunit ribosomal proteins can be categorised as primary binding proteins, which bind directly and independently to 16S rRNA; secondary binding proteins, which display no specific affinity for 16S rRNA, but its assembly is contingent upon the presence of one or more primary binding proteins; and tertiary binding proteins, which require the presence of one or more secondary binding proteins and sometimes other tertiary binding proteins. The small ribosomal subunit protein S18 is known to be involved in binding the aminoacyl-tRNA complex in Escherichia coli [], and appears to be situated at the tRNA A-site. Experimental evidence has revealed that S18 is well exposed on the surface of the E. coli ribosome, and is a secondary rRNA binding protein []. S18 belongs to a family of ribosomal proteins [] that includes: eubacterial S18; metazoan mitochondrial S18, algal and plant chloroplast S18; and cyanelle S18.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2UXD_R 3I8G_U 3UZ7_U 1N33_R 2XSY_R 3V24_R 3OGY_R 2XUY_R 2XFZ_R 3UXT_R ....
Probab=21.77  E-value=11  Score=23.02  Aligned_cols=15  Identities=47%  Similarity=0.831  Sum_probs=10.4

Q ss_pred             EEEeecCCEeeeCCCC
Q 045565           35 RFMCSFGGKILPRPHD   50 (83)
Q Consensus        35 KllCSyGGrIlPRp~D   50 (83)
                      +|+.. .|+|+||--.
T Consensus        17 ~Fi~~-~GkIl~rr~T   31 (54)
T PF01084_consen   17 QFISP-TGKILPRRIT   31 (54)
T ss_dssp             CGBTT-SSSBSTHHHH
T ss_pred             HHcCc-ccceehhhhc
Confidence            35555 8999998533


No 87 
>TIGR01687 moaD_arch MoaD family protein, archaeal. Members of this family appear to be archaeal versions of MoaD, subunit 1 of molybdopterin converting factor. This model has been split from the bacterial/eukaryotic equivalog model TIGR01682 because the presence of two members of this family in a substantial number of archaeal species suggests that roles might not be interchangeable.
Probab=21.50  E-value=1.4e+02  Score=18.19  Aligned_cols=25  Identities=20%  Similarity=0.335  Sum_probs=18.7

Q ss_pred             ecCceeEEEEcCCCChHHHHHHHHhh
Q 045565           56 VGGDTRIVAVHRSSTFSTLLTKLSKL   81 (83)
Q Consensus        56 vGGeTRIisV~R~isf~eL~~Kls~l   81 (83)
                      +|..+..|.++ ..+..||++.|.+.
T Consensus        13 ~g~~~~~v~~~-~~tv~~l~~~l~~~   37 (88)
T TIGR01687        13 TGKKSEEIEIE-GKTVGDLLNELMAR   37 (88)
T ss_pred             hCCceEEEEeC-CCCHHHHHHHHHHH
Confidence            34445566777 89999999999764


No 88 
>PRK02240 GTP cyclohydrolase III; Provisional
Probab=21.29  E-value=1.6e+02  Score=23.31  Aligned_cols=31  Identities=26%  Similarity=0.390  Sum_probs=21.6

Q ss_pred             CCCCeEEecCceeEEEEcCCC---ChHHHHHHHHh
Q 045565           49 HDNQLRYVGGDTRIVAVHRSS---TFSTLLTKLSK   80 (83)
Q Consensus        49 ~Dg~LrYvGGeTRIisV~R~i---sf~eL~~Kls~   80 (83)
                      +++-.-|+|||+-| +|-.++   +|.+.+..+.+
T Consensus       177 ~g~l~ff~GGDN~~-~~~~~l~~~~~~~~i~~i~~  210 (254)
T PRK02240        177 HDALSFFVGGDNFM-APCPGLSEGDFLDAIEHVRE  210 (254)
T ss_pred             cCcEEEEecCceEE-EECCCCCHHHHHHHHHHHhh
Confidence            55667899999854 555667   67777666543


No 89 
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional
Probab=20.69  E-value=11  Score=28.25  Aligned_cols=17  Identities=24%  Similarity=0.440  Sum_probs=13.9

Q ss_pred             ecCCEeeeCCCCCCeEEe
Q 045565           39 SFGGKILPRPHDNQLRYV   56 (83)
Q Consensus        39 SyGGrIlPRp~Dg~LrYv   56 (83)
                      =|.||++| .|-|.|.++
T Consensus         8 v~iGRFQP-fH~GHl~~I   24 (196)
T PRK13793          8 VFIGRFQP-FHLAHMQTI   24 (196)
T ss_pred             EEEecCCC-CcHHHHHHH
Confidence            38899999 788888765


No 90 
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB). The ACT_PSP_1 CD includes the first of the two ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB). PSPs belong to the L-2-haloacid dehalogenase-like protein superfamily. PSP is involved in serine metabolism; serine is synthesized from phosphoglycerate through sequential reactions catalyzed by 3-phosphoglycerate dehydrogenase (SerA), 3-phosphoserine aminotransferase (SerC), and SerB. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=20.67  E-value=1.5e+02  Score=17.65  Aligned_cols=21  Identities=29%  Similarity=0.264  Sum_probs=17.8

Q ss_pred             EEEEcCCCChHHHHHHHHhhh
Q 045565           62 IVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        62 IisV~R~isf~eL~~Kls~l~   82 (83)
                      .+.++.+.++.+|.+.|.++|
T Consensus        44 ~v~~p~~~~~~~l~~~l~~l~   64 (75)
T cd04870          44 LVQIPDSADSEALLKDLLFKA   64 (75)
T ss_pred             EEEcCCCCCHHHHHHHHHHHH
Confidence            667788889999999998876


No 91 
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]
Probab=20.60  E-value=1.1e+02  Score=29.16  Aligned_cols=25  Identities=20%  Similarity=0.473  Sum_probs=21.4

Q ss_pred             ceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           59 DTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        59 eTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      |-.-|+|+|.++|.|-++|-.++.|
T Consensus      1102 ElhtIsVERGmsWEeA~~k~~elt~ 1126 (1300)
T KOG1513|consen 1102 ELHTISVERGMSWEEAFAKYKELTG 1126 (1300)
T ss_pred             EEEEEEeccCccHHHHHHHHHhhcC
Confidence            4567999999999999999888764


No 92 
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=20.41  E-value=1.6e+02  Score=16.13  Aligned_cols=27  Identities=19%  Similarity=0.273  Sum_probs=20.7

Q ss_pred             eEEEEeecCCEeeeCCCCCCeEEecCc
Q 045565           33 RVRFMCSFGGKILPRPHDNQLRYVGGD   59 (83)
Q Consensus        33 kvKllCSyGGrIlPRp~Dg~LrYvGGe   59 (83)
                      .-.|.-...|.|.|.+.+..-.|.-|.
T Consensus         5 ~~~~~I~~dG~v~pC~~~~~~~~~~Gn   31 (64)
T PF13186_consen    5 WNSLYIDPDGDVYPCCHDYDPEFKIGN   31 (64)
T ss_pred             CeEEEEeeCccEEeCCCCCCCCeEEee
Confidence            345667789999999888766776665


No 93 
>cd06257 DnaJ DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification.
Probab=20.38  E-value=64  Score=17.56  Aligned_cols=22  Identities=23%  Similarity=0.243  Sum_probs=16.4

Q ss_pred             eEEEEcCCCChHHHHHHHHhhh
Q 045565           61 RIVAVHRSSTFSTLLTKLSKLA   82 (83)
Q Consensus        61 RIisV~R~isf~eL~~Kls~l~   82 (83)
                      .|+.|+++.+..++.++..+|+
T Consensus         4 ~vLgl~~~~~~~~ik~~y~~l~   25 (55)
T cd06257           4 DILGVPPDASDEEIKKAYRKLA   25 (55)
T ss_pred             HHcCCCCCCCHHHHHHHHHHHH
Confidence            4677888999998887766553


No 94 
>PF14847 Ras_bdg_2:  Ras-binding domain of Byr2; PDB: 1I35_A 1K8R_B.
Probab=20.27  E-value=1.2e+02  Score=20.70  Aligned_cols=30  Identities=20%  Similarity=0.187  Sum_probs=21.6

Q ss_pred             EEecCceeEEEEcCCCChHHHHHHHHhhhC
Q 045565           54 RYVGGDTRIVAVHRSSTFSTLLTKLSKLAG   83 (83)
Q Consensus        54 rYvGGeTRIisV~R~isf~eL~~Kls~l~G   83 (83)
                      -+-+|.||.|-|..=-+-.|++.|.-+-.|
T Consensus         6 I~~dG~tk~VNV~~c~~a~eI~~rvLKKfg   35 (105)
T PF14847_consen    6 ILEDGSTKTVNVSGCFNAQEIKRRVLKKFG   35 (105)
T ss_dssp             EETTTEEEEEE--S--HHHHHHHHHHHHHT
T ss_pred             ECCCCcEEEEEECCCCCHHHHHHHHHHHcC
Confidence            466899999999999999999988876554


No 95 
>PF01357 Pollen_allerg_1:  Pollen allergen;  InterPro: IPR007117 Expansins are unusual proteins that mediate cell wall extension in plants []. They are believed to act as a sort of chemical grease, allowing polymers to slide past one another by disrupting non-covalent hydrogen bonds that hold many wall polymers to one another. This process is not degradative and hence does not weaken the wall, which could otherwise rupture under internal pressure during growth. Sequence comparisons indicate at least four distinct expansin cDNAs in rice and at least six in Arabidopsis. The proteins are highly conserved in size and sequence (75-95% amino acid sequence similarity between any pairwise comparison), and phylogenetic trees indicate that this multigene family formed before the evolutionary divergence of monocotyledons and dicotyledons []. Sequence and motif analyses show no similarities to known functional domains that might account for expansin action on wall extension. It is thought that several highly-conserved tryptophans may function in expansin binding to cellulose, or other glycans. The high conservation of the family indicates that the mechanism by which expansins promote wall extensin tolerates little variation in protein structure.  Grass pollens, such as pollen from timothy grass, represent a major cause of type I allergy []. Interestingly, expansins share a high degree of sequence similarity with the Lol p I family of allergens. This entry represents the C-terminal domain.; PDB: 2VXQ_A 1WHP_A 1BMW_A 1WHO_A 2HCZ_X 2JNZ_A 3FT9_A 3FT1_C 1N10_B.
Probab=20.18  E-value=75  Score=20.12  Aligned_cols=15  Identities=47%  Similarity=0.665  Sum_probs=11.3

Q ss_pred             CeEEecCceeEEEEc
Q 045565           52 QLRYVGGDTRIVAVH   66 (83)
Q Consensus        52 ~LrYvGGeTRIisV~   66 (83)
                      .+.|+||..-|.+|.
T Consensus        17 ~v~n~gG~gdi~~Ve   31 (82)
T PF01357_consen   17 LVKNVGGDGDIKAVE   31 (82)
T ss_dssp             EEEECCTTS-EEEEE
T ss_pred             EEEEcCCCccEEEEE
Confidence            368999999888874


Done!