BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045614
         (123 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3OMG|A Chain A, Structure Of Human Snd1 Extended Tudor Domain In Complex
           With The Symmetrically Dimethylated Arginine Piwil1
           Peptide R14me2s
 pdb|3OMG|B Chain B, Structure Of Human Snd1 Extended Tudor Domain In Complex
           With The Symmetrically Dimethylated Arginine Piwil1
           Peptide R14me2s
 pdb|3OMC|A Chain A, Structure Of Human Snd1 Extended Tudor Domain In Complex
           With The Symmetrically Dimethylated Arginine Piwil1
           Peptide R4me2s
 pdb|3OMC|B Chain B, Structure Of Human Snd1 Extended Tudor Domain In Complex
           With The Symmetrically Dimethylated Arginine Piwil1
           Peptide R4me2s
          Length = 261

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 77  NPTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQ 119
            P EEV+      + S     +F+  ITD LH+Y++++    Q
Sbjct: 15  QPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQ 57


>pdb|2HQX|A Chain A, Crystal Structure Of Human P100 Tudor Domain Conserved
           Region
 pdb|2HQX|B Chain B, Crystal Structure Of Human P100 Tudor Domain Conserved
           Region
 pdb|2HQE|A Chain A, Crystal Structure Of Human P100 Tudor Domain: Large
           Fragment
 pdb|2HQE|B Chain B, Crystal Structure Of Human P100 Tudor Domain: Large
           Fragment
          Length = 246

 Score = 26.9 bits (58), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 22/42 (52%)

Query: 78  PTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQ 119
           P EEV+      + S     +F+  ITD LH+Y++++    Q
Sbjct: 1   PVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQ 42


>pdb|3IF5|A Chain A, Crystal Structure Analysis Of Mglu
 pdb|3IH8|A Chain A, Crystal Structure Analysis Of Mglu In Its Native Form
 pdb|3IH8|B Chain B, Crystal Structure Analysis Of Mglu In Its Native Form
 pdb|3IH9|A Chain A, Crystal Structure Analysis Of Mglu In Its Tris Form
 pdb|3IH9|B Chain B, Crystal Structure Analysis Of Mglu In Its Tris Form
 pdb|3IHA|A Chain A, Crystal Structure Analysis Of Mglu In Its Glutamate Form
 pdb|3IHA|B Chain B, Crystal Structure Analysis Of Mglu In Its Glutamate Form
 pdb|3IHB|A Chain A, Crystal Structure Analysis Of Mglu In Its Tris And
           Glutamate Form
 pdb|3IHB|B Chain B, Crystal Structure Analysis Of Mglu In Its Tris And
           Glutamate Form
 pdb|3AGD|A Chain A, Crystal Structure Of Mglu In Its Native Form In The
           Presence Of 4.3m Nacl
 pdb|3AGD|B Chain B, Crystal Structure Of Mglu In Its Native Form In The
           Presence Of 4.3m Nacl
 pdb|3AGE|A Chain A, Crystal Structure Of Mglu In Its L-Glutamate Binding Form
           In The Presence Of 4.3m Nacl
 pdb|3AGE|B Chain B, Crystal Structure Of Mglu In Its L-Glutamate Binding Form
           In The Presence Of 4.3m Nacl
          Length = 456

 Score = 26.2 bits (56), Expect = 5.2,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 72  EGGAINPTEEVLMANLLLQASLMGFSLFLAMITDRLH 108
           E GA+NP E      +L +A    F + LA  T RLH
Sbjct: 15  ELGAVNPGETAQYIPVLAEADPDRFGIALATPTGRLH 51


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.144    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,867,266
Number of Sequences: 62578
Number of extensions: 88688
Number of successful extensions: 244
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 243
Number of HSP's gapped (non-prelim): 5
length of query: 123
length of database: 14,973,337
effective HSP length: 85
effective length of query: 38
effective length of database: 9,654,207
effective search space: 366859866
effective search space used: 366859866
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)