BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 045620
         (98 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1F8R|A Chain A, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma Complexed With Citrate
 pdb|1F8R|B Chain B, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma Complexed With Citrate
 pdb|1F8R|C Chain C, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma Complexed With Citrate
 pdb|1F8R|D Chain D, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma Complexed With Citrate
 pdb|1F8S|A Chain A, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|1F8S|B Chain B, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|1F8S|C Chain C, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|1F8S|D Chain D, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|1F8S|E Chain E, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|1F8S|F Chain F, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|1F8S|G Chain G, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|1F8S|H Chain H, Crystal Structure Of L-Amino Acid Oxidase From
           Calloselasma Rhodostoma, Complexed With Three Molecules
           Of O-Aminobenzoate.
 pdb|2IID|A Chain A, Structure Of L-Amino Acid Oxidase From Calloselasma
           Rhodostoma In Complex With L-Phenylalanine
 pdb|2IID|B Chain B, Structure Of L-Amino Acid Oxidase From Calloselasma
           Rhodostoma In Complex With L-Phenylalanine
 pdb|2IID|C Chain C, Structure Of L-Amino Acid Oxidase From Calloselasma
           Rhodostoma In Complex With L-Phenylalanine
 pdb|2IID|D Chain D, Structure Of L-Amino Acid Oxidase From Calloselasma
           Rhodostoma In Complex With L-Phenylalanine
          Length = 498

 Score = 26.2 bits (56), Expect = 4.8,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 62  FDSAVDGCEEVPTATGRFAVVGRVAHDYEVLKILHED 98
           FD  VDG +++PTA  R  +  +V  + +V+KI   D
Sbjct: 233 FDEIVDGMDKLPTAMYR-DIQDKVHFNAQVIKIQQND 268


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.137    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,220,098
Number of Sequences: 62578
Number of extensions: 53785
Number of successful extensions: 36
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 36
Number of HSP's gapped (non-prelim): 1
length of query: 98
length of database: 14,973,337
effective HSP length: 64
effective length of query: 34
effective length of database: 10,968,345
effective search space: 372923730
effective search space used: 372923730
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 45 (21.9 bits)